AMPDB_3580 | Sarcotoxin-1B
PEPTIDE SUMMARY
Sarcotoxin-1B
1 General Description
AMPDB ID: AMPDB_3580
Protein Names: Sarcotoxin-1B (Sarcotoxin IB)
Protein Family: Cecropin family
Gene Name: Nil
Protein Length: 63 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MNFNKVFIFVALILAVFAGQSQAGWLKKIGKKIERVGQHTRDATIQVIGVAQQAANVAATARG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 11, 'R': 3, 'N': 3, 'D': 1, 'C': 0, 'Q': 6, 'E': 1, 'G': 6, 'H': 1, 'I': 6, 'L': 3, 'K': 5, 'M': 1, 'F': 4, 'P': 0, 'S': 1, 'T': 3, 'W': 1, 'Y': 0, 'V': 7
Frequencies of Amino Acids
'A': 17.46%, 'R': 4.76%, 'N': 4.76%, 'D': 1.59%, 'C': 0%, 'Q': 9.52%, 'E': 1.59%, 'G': 9.52%, 'H': 1.59%, 'I': 9.52%, 'L': 4.76%, 'K': 7.94%, 'M': 1.59%, 'F': 6.35%, 'P': 0%, 'S': 1.59%, 'T': 4.76%, 'W': 1.59%, 'Y': 0%, 'V': 11.11%
Missing Amino Acid(s)
C, P, Y
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
D, E, H, M, S, W
Hydrophobic Amino Acid(s) Count
39
Hydrophilic Amino Acid(s) Count
24
Basic Amino Acid(s) Count
2
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 6752.94 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 105.397 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 26.425 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.314 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.936 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 11.777 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 6.09 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.333, 0.159, 0.254 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.079 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 5500, 5500 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytotoxin, Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Kanai A, Natori S, Natori S. Cloning of gene cluster for sarcotoxin I, antibacterial proteins of Sarcophaga peregrina. FEBS Lett. 1989;258(2):199-202. Published 1989 Dec 4. doi:10.1016/0014-5793(89)81652-7
PMID: 2689214
Citation 2: Okada M, Natori S, Natori S. Primary structure of sarcotoxin I, an antibacterial protein induced in the hemolymph of Sarcophaga peregrina (flesh fly) larvae. J Biol Chem. 1985;260(12):7174-7. Published 1985 Jun 25. doi:
PMID: 3888997
5.2 Protein Sequence Databases
UniProt: P08376
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P08376
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. X17315 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR000875, IPR020400
PANTHER: PTHR38329
PROSITE: PS00268
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India