AMPDB_3579 | Sarcotoxin-1A

PEPTIDE SUMMARY

Sarcotoxin-1A

1 General Description

AMPDB ID: AMPDB_3579

Protein Names: Sarcotoxin-1A (Sarcotoxin IA)

Protein Family: Cecropin family

Gene Name: Nil

Source Organism: Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina)

Protein Length: 63 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFQNIFIFVALILAVFAGQSQAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 3, 'N': 3, 'D': 1, 'C': 0, 'Q': 7, 'E': 1, 'G': 7, 'H': 1, 'I': 7, 'L': 4, 'K': 4, 'M': 1, 'F': 4, 'P': 0, 'S': 1, 'T': 3, 'W': 1, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 17.46%, 'R': 4.76%, 'N': 4.76%, 'D': 1.59%, 'C': 0%, 'Q': 11.11%, 'E': 1.59%, 'G': 11.11%, 'H': 1.59%, 'I': 11.11%, 'L': 6.35%, 'K': 6.35%, 'M': 1.59%, 'F': 6.35%, 'P': 0%, 'S': 1.59%, 'T': 4.76%, 'W': 1.59%, 'Y': 0%, 'V': 6.35%

Missing Amino Acid(s)

C, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, E, H, M, S, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6738.87 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	103.968	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	30.838	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.246	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.936	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.722	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.09	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.317, 0.175, 0.27 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.079	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Matsumoto N, Okada M, Takahashi H, et al. Molecular cloning of a cDNA and assignment of the C-terminal of sarcotoxin IA, a potent antibacterial protein of Sarcophaga peregrina. Biochem J. 1986;239(3):717-22. Published 1986 Nov 1. doi:10.1042/bj2390717

PMID: 3827823

Citation 2: Okada M, Natori S, Natori S. Primary structure of sarcotoxin I, an antibacterial protein induced in the hemolymph of Sarcophaga peregrina (flesh fly) larvae. J Biol Chem. 1985;260(12):7174-7. Published 1985 Jun 25. doi:

PMID: 3888997

Citation 3: Iwai H, Nakajima Y, Natori S, et al. Solution conformation of an antibacterial peptide, sarcotoxin IA, as determined by 1H-NMR. Eur J Biochem. 1993;217(2):639-44. Published 1993 Oct 15. doi:10.1111/j.1432-1033.1993.tb18287.x

PMID: 8223606

5.2 Protein Sequence Databases

UniProt: P08375

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P08375

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M25612	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download