AMPDB_35732 | Opistoporin-4

PEPTIDE SUMMARY

Opistoporin-4

1 General Description

AMPDB ID: AMPDB_35732

Protein Names: Opistoporin-4

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Long chain multifunctional peptide (group 2) family

Gene Name: Nil

Source Organism: Opistophthalmus carinatus (African yellow leg scorpion)

Protein Length: 61 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPSEAGQMPFDEFMDILHYY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 0, 'N': 4, 'D': 5, 'C': 0, 'Q': 2, 'E': 3, 'G': 3, 'H': 1, 'I': 3, 'L': 4, 'K': 9, 'M': 2, 'F': 3, 'P': 2, 'S': 2, 'T': 2, 'W': 2, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 13.11%, 'R': 0%, 'N': 6.56%, 'D': 8.2%, 'C': 0%, 'Q': 3.28%, 'E': 4.92%, 'G': 4.92%, 'H': 1.64%, 'I': 4.92%, 'L': 6.56%, 'K': 14.75%, 'M': 3.28%, 'F': 4.92%, 'P': 3.28%, 'S': 3.28%, 'T': 3.28%, 'W': 3.28%, 'Y': 3.28%, 'V': 6.56%

Missing Amino Acid(s)

C, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6885.92 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	76.885	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.867	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.443	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.718	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.092	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.295, 0.18, 0.279 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.115	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 13980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: Q5VJS9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5VJS9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY427949	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012526

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download