AMPDB_35667 | Bacteriocin leucocin-B

PEPTIDE SUMMARY

Bacteriocin leucocin-B

1 General Description

AMPDB ID: AMPDB_35667

Protein Names: Bacteriocin leucocin-B (Leucocin B-Ta11a)

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: Nil

Source Organism: Leuconostoc carnosum

Protein Length: 61 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNNMKSADNYQQLDNNALEQVVGGKYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 1, 'N': 9, 'D': 2, 'C': 2, 'Q': 3, 'E': 2, 'G': 10, 'H': 2, 'I': 0, 'L': 3, 'K': 3, 'M': 2, 'F': 2, 'P': 0, 'S': 4, 'T': 1, 'W': 2, 'Y': 3, 'V': 5

Frequencies of Amino Acids

'A': 8.2%, 'R': 1.64%, 'N': 14.75%, 'D': 3.28%, 'C': 3.28%, 'Q': 4.92%, 'E': 3.28%, 'G': 16.39%, 'H': 3.28%, 'I': 0%, 'L': 4.92%, 'K': 4.92%, 'M': 3.28%, 'F': 3.28%, 'P': 0%, 'S': 6.56%, 'T': 1.64%, 'W': 3.28%, 'Y': 4.92%, 'V': 8.2%

Missing Amino Acid(s)

I, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

R, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6568.18 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	51.148	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	5.949	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.597	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.528	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.413	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.057	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.246, 0.377, 0.197 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.115	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15595	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

L.monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Felix JV, Papathanasopoulos MA, Smith AA, et al. Characterization of leucocin B-Ta11a: a bacteriocin from Leuconostoc carnosum Ta11a isolated from meat. Curr Microbiol. 1994;29(4):207-12. Published 1994 Oct. doi:10.1007/BF01570155

PMID: 7765496

5.2 Protein Sequence Databases

UniProt: Q53446

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q53446

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	S72922	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388, IPR004288

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download