AMPDB_35628 | Bacteriocin lactacin-F subunit LafX

PEPTIDE SUMMARY

Bacteriocin lactacin-F subunit LafX

1 General Description

AMPDB ID: AMPDB_35628

Protein Names: Bacteriocin lactacin-F subunit LafX

Protein Family: Bacteriocin class IIB family

Gene Name: lafX LJ_0769.1 LJ_0769b

Source Organism: Lactobacillus johnsonii (strain CNCM I-12250 La1 NCC 533)

Protein Length: 62 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MKLNDKELSKIVGGNRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 1, 'N': 3, 'D': 2, 'C': 2, 'Q': 0, 'E': 1, 'G': 14, 'H': 1, 'I': 4, 'L': 3, 'K': 5, 'M': 2, 'F': 2, 'P': 1, 'S': 4, 'T': 3, 'W': 2, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 11.29%, 'R': 1.61%, 'N': 4.84%, 'D': 3.23%, 'C': 3.23%, 'Q': 0%, 'E': 1.61%, 'G': 22.58%, 'H': 1.61%, 'I': 6.45%, 'L': 4.84%, 'K': 8.06%, 'M': 3.23%, 'F': 3.23%, 'P': 1.61%, 'S': 6.45%, 'T': 4.84%, 'W': 3.23%, 'Y': 3.23%, 'V': 4.84%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, H, P, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6250.15 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	69.355	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	9.802	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.063	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.554	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.308	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.964	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.258, 0.355, 0.21 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.097	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Enterococcus faecalis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Fremaux C, Ahn C, Klaenhammer TR, et al. Molecular analysis of the lactacin F operon. Appl Environ Microbiol. 1993;59(11):3906-15. Published 1993 Nov. doi:10.1128/aem.59.11.3906-3915.1993

PMID: 8285694

Citation 2: Pridmore RD, Berger B, Desiere F, et al. The genome sequence of the probiotic intestinal bacterium Lactobacillus johnsonii NCC 533. Proc Natl Acad Sci U S A. 2004;101(8):2512-7. Published 2004 Feb 24. doi:10.1073/pnas.0307327101

PMID: 14983040

5.2 Protein Sequence Databases

UniProt: Q48509

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q48509

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M57961	GenBank \|\| EMBL
2.	AE017198	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_011161712.1

5.5 Protein-Protein Interaction Databases

STRING: 257314.LJ_0769b

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR019493, IPR010133

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ljo:LJ_0769b

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download