AMPDB_354 | Histone H2B

PEPTIDE SUMMARY

Histone H2B

1 General Description

AMPDB ID: AMPDB_354

Protein Names: Histone H2B

Protein Family: Histone H2B family

Gene Name: histh2b

Source Organism: Zhangixalus schlegelii (Japanese gliding frog) (Rhacophorus schlegelii)

Protein Length: 126 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MPEPAKSAPAAKKGSKKAVSKVQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 8, 'N': 3, 'D': 3, 'C': 0, 'Q': 3, 'E': 7, 'G': 6, 'H': 3, 'I': 7, 'L': 6, 'K': 20, 'M': 3, 'F': 2, 'P': 5, 'S': 14, 'T': 7, 'W': 0, 'Y': 5, 'V': 9

Frequencies of Amino Acids

'A': 11.9%, 'R': 6.35%, 'N': 2.38%, 'D': 2.38%, 'C': 0%, 'Q': 2.38%, 'E': 5.56%, 'G': 4.76%, 'H': 2.38%, 'I': 5.56%, 'L': 4.76%, 'K': 15.87%, 'M': 2.38%, 'F': 1.59%, 'P': 3.97%, 'S': 11.11%, 'T': 5.56%, 'W': 0%, 'Y': 3.97%, 'V': 7.14%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13906.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	72.857	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	47.125	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.652	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.769	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.004	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	18.274	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.23, 0.222, 0.246 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	7450, 7450	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kawasaki H, Isaacson T, Iwamuro S, et al. A protein with antimicrobial activity in the skin of Schlegel's green tree frog Rhacophorus schlegelii (Rhacophoridae) identified as histone H2B. Biochem Biophys Res Commun. 2003;312(4):1082-6. Published 2003 Dec 26. doi:10.1016/j.bbrc.2003.11.052

PMID: 14651982

5.2 Protein Sequence Databases

UniProt: Q75VN4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q75VN4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB124798	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR009072, IPR007125, IPR000558

PANTHER: PTHR23428

PROSITE: PS00357

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download