AMPDB_3535 | Cecropin-D

PEPTIDE SUMMARY

Cecropin-D

1 General Description

AMPDB ID: AMPDB_3535

Protein Names: Cecropin-D

Protein Family: Cecropin family

Gene Name: CECD

Source Organism: Bombyx mori (Silk moth)

Protein Length: 61 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKFSKIFVFVFAIVFATASVSAAPGNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 2, 'N': 1, 'D': 3, 'C': 0, 'Q': 2, 'E': 1, 'G': 4, 'H': 0, 'I': 3, 'L': 3, 'K': 6, 'M': 2, 'F': 7, 'P': 2, 'S': 4, 'T': 2, 'W': 0, 'Y': 0, 'V': 7

Frequencies of Amino Acids

'A': 19.67%, 'R': 3.28%, 'N': 1.64%, 'D': 4.92%, 'C': 0%, 'Q': 3.28%, 'E': 1.64%, 'G': 6.56%, 'H': 0%, 'I': 4.92%, 'L': 4.92%, 'K': 9.84%, 'M': 3.28%, 'F': 11.48%, 'P': 3.28%, 'S': 6.56%, 'T': 3.28%, 'W': 0%, 'Y': 0%, 'V': 11.48%

Missing Amino Acid(s)

C, H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6435.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.312	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	10.621	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.541	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.788	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.791	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.999	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.328, 0.18, 0.295 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.115	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yang J, Furukawa S, Sagisaka A, et al. cDNA cloning and gene expression of cecropin D, an antibacterial protein in the silkworm, Bombyx mori. Comp Biochem Physiol B Biochem Mol Biol. 1999;122(4):409-14. Published 1999 Apr. doi:10.1016/s0305-0491(99)00015-2

PMID: 10392453

5.2 Protein Sequence Databases

UniProt: O76146

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O76146

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB010825	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001036833.1

5.5 Protein-Protein Interaction Databases

STRING: 7091.BGIBMGA000017-TA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bmor:692369

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download