AMPDB_35265 | Dermaseptin-H3

PEPTIDE SUMMARY

Dermaseptin-H3

1 General Description

AMPDB ID: AMPDB_35265

Protein Names: Dermaseptin-H3 (Dermaseptin-like peptide 3) (DMS3)

Protein Family: Frog skin active peptide (FSAP) family; Dermaseptin subfamily

Gene Name: dpp-H3

Source Organism: Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea)

Protein Length: 69 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGMVSLSICEEEKRENEDEEKQEDDEQSEMKRGLWSTIKNVAAAAGKAALGALGEQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 2, 'N': 2, 'D': 3, 'C': 1, 'Q': 3, 'E': 11, 'G': 5, 'H': 0, 'I': 2, 'L': 9, 'K': 7, 'M': 3, 'F': 3, 'P': 0, 'S': 5, 'T': 1, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 11.59%, 'R': 2.9%, 'N': 2.9%, 'D': 4.35%, 'C': 1.45%, 'Q': 4.35%, 'E': 15.94%, 'G': 7.25%, 'H': 0%, 'I': 2.9%, 'L': 13.04%, 'K': 10.14%, 'M': 4.35%, 'F': 4.35%, 'P': 0%, 'S': 7.25%, 'T': 1.45%, 'W': 1.45%, 'Y': 0%, 'V': 4.35%

Missing Amino Acid(s)

H, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7662.74 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	86.377	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	58.001	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.342	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.644	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.336	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-5.045	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.261, 0.174, 0.449 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.058	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Thompson AH, Bjourson AJ, Orr DF, et al. A combined mass spectrometric and cDNA sequencing approach to the isolation and characterization of novel antimicrobial peptides from the skin secretions of Phyllomedusa hypochondrialis azurea. Peptides. 2007;28(7):1331-43. Published 2007 Jul. doi:10.1016/j.peptides.2007.05.001

PMID: 17553595

5.2 Protein Sequence Databases

UniProt: Q17UY8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q17UY8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM269412	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR022731, IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download