AMPDB_35255 | Ceratotoxin-C

PEPTIDE SUMMARY

Ceratotoxin-C

1 General Description

AMPDB ID: AMPDB_35255

Protein Names: Ceratotoxin-C

Protein Family: Nil

Gene Name: CTXC1; CTCX2

Source Organism: Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)

Protein Length: 67 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MANIKAVFLICIVAFIAFHCVVAEPTAEDSVVVKRSLGGVISGAKKVAKVAIPIGKAVLPVVAKLVG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 1, 'N': 1, 'D': 1, 'C': 2, 'Q': 0, 'E': 2, 'G': 5, 'H': 1, 'I': 7, 'L': 4, 'K': 7, 'M': 1, 'F': 3, 'P': 3, 'S': 3, 'T': 1, 'W': 0, 'Y': 0, 'V': 14

Frequencies of Amino Acids

'A': 16.42%, 'R': 1.49%, 'N': 1.49%, 'D': 1.49%, 'C': 2.99%, 'Q': 0%, 'E': 2.99%, 'G': 7.46%, 'H': 1.49%, 'I': 10.45%, 'L': 5.97%, 'K': 10.45%, 'M': 1.49%, 'F': 4.48%, 'P': 4.48%, 'S': 4.48%, 'T': 1.49%, 'W': 0%, 'Y': 0%, 'V': 20.9%

Missing Amino Acid(s)

Q, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, M, N, R, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6828.41 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	141.045	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.767	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	1.219	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.591	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.412	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.967	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.418, 0.179, 0.269 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.045	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Rosetto M, Manetti AG, Giordano PC, et al. Molecular characterization of ceratotoxin C, a novel antibacterial female-specific peptide of the ceratotoxin family from the medfly Ceratitis capitata. Eur J Biochem. 1996;241(2):330-7. Published 1996 Oct 15. doi:10.1111/j.1432-1033.1996.00330.x

PMID: 8917427

Citation 2: Rosetto M, De Filippis T, Manetti AG, et al. The genes encoding the antibacterial sex-specific peptides ceratotoxins are clustered in the genome of the medfly Ceratitis capitata. Insect Biochem Mol Biol. 1997;27(12):1039-46. Published 1997 Dec. doi:10.1016/s0965-1748(97)00090-8

PMID: 9569644

5.2 Protein Sequence Databases

UniProt: Q17313

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q17313

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L76300	GenBank \|\| EMBL
2.	Y15374	GenBank \|\| EMBL
3.	Y15375	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_004523345.1, XP_004523346.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ccat:101462561, ccat:101463108

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download