AMPDB_35186 | Defensin Ec-AMP-D2
PEPTIDE SUMMARY
Defensin Ec-AMP-D2
1 General Description
AMPDB ID: AMPDB_35186
Protein Names: Defensin Ec-AMP-D2
Protein Family: DEFL family
Gene Name: Nil
Protein Length: 47 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKHC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 2, 'R': 4, 'N': 1, 'D': 1, 'C': 8, 'Q': 3, 'E': 2, 'G': 6, 'H': 3, 'I': 0, 'L': 0, 'K': 3, 'M': 0, 'F': 3, 'P': 0, 'S': 4, 'T': 3, 'W': 0, 'Y': 1, 'V': 3
Frequencies of Amino Acids
'A': 4.26%, 'R': 8.51%, 'N': 2.13%, 'D': 2.13%, 'C': 17.02%, 'Q': 6.38%, 'E': 4.26%, 'G': 12.77%, 'H': 6.38%, 'I': 0%, 'L': 0%, 'K': 6.38%, 'M': 0%, 'F': 6.38%, 'P': 0%, 'S': 8.51%, 'T': 6.38%, 'W': 0%, 'Y': 2.13%, 'V': 6.38%
Missing Amino Acid(s)
I, L, M, P, W
Most Occurring Amino Acid(s)
C
Less Occurring Amino Acid(s)
D, N, Y
Hydrophobic Amino Acid(s) Count
14
Hydrophilic Amino Acid(s) Count
33
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
10
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 5173.84 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 22.766 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 40.879 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.6 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.373 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.415 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 3.777 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.149, 0.234, 0.085 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.085 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1990 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
F.oxysporum, P.infestans
4.2 Antimicrobial Activity
Antimicrobial, Defensin, Fungicide, Plant defense
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Odintsova TI, Rogozhin EA, Baranov Y, et al. Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv. Biochimie. 2008;90(11-12):1667-73. Published 2008 Nov-Dec. doi:10.1016/j.biochi.2008.06.007
PMID: 18625284
5.2 Protein Sequence Databases
UniProt: P86519
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P86519
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS00940
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India