AMPDB_35184 | Papillosin

PEPTIDE SUMMARY

Papillosin

1 General Description

AMPDB ID: AMPDB_35184

Protein Names: Papillosin

Protein Family: Nil

Gene Name: Nil

Source Organism: Halocynthia papillosa (Red sea-squirt)

Protein Length: 34 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 0, 'N': 1, 'D': 0, 'C': 0, 'Q': 1, 'E': 0, 'G': 7, 'H': 1, 'I': 1, 'L': 2, 'K': 5, 'M': 0, 'F': 1, 'P': 0, 'S': 1, 'T': 0, 'W': 2, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 26.47%, 'R': 0%, 'N': 2.94%, 'D': 0%, 'C': 0%, 'Q': 2.94%, 'E': 0%, 'G': 20.59%, 'H': 2.94%, 'I': 2.94%, 'L': 5.88%, 'K': 14.71%, 'M': 0%, 'F': 2.94%, 'P': 0%, 'S': 2.94%, 'T': 0%, 'W': 5.88%, 'Y': 0%, 'V': 8.82%

Missing Amino Acid(s)

C, D, E, M, P, R, T, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H, I, N, Q, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3320.89 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	86.471	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	13.506	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.253	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.47	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.403	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.087	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.265, 0.265, 0.324 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11000, 11000	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.viridans (Gram-positive), B.megaterium, E.coli (Gram-negative), E.faecalis (Gram-positive), K.pneumoniae (Gram-negative), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Galinier R, Roger E, Sautiere PE, et al. Halocyntin and papillosin, two new antimicrobial peptides isolated from hemocytes of the solitary tunicate, Halocynthia papillosa. J Pept Sci. 2009;15(1):48-55. Published 2009 Jan. doi:10.1002/psc.1101

PMID: 19085906

5.2 Protein Sequence Databases

UniProt: P86416

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P86416

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download