AMPDB_35126 | Perinerin

PEPTIDE SUMMARY

Perinerin

1 General Description

AMPDB ID: AMPDB_35126

Protein Names: Perinerin

Protein Family: Nil

Gene Name: Nil

Source Organism: Perinereis aibuhitensis (Clamworm) (Nereis aibuhitensis)

Protein Length: 51 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 8, 'N': 2, 'D': 1, 'C': 4, 'Q': 1, 'E': 2, 'G': 3, 'H': 1, 'I': 2, 'L': 2, 'K': 6, 'M': 1, 'F': 3, 'P': 1, 'S': 5, 'T': 1, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 7.84%, 'R': 15.69%, 'N': 3.92%, 'D': 1.96%, 'C': 7.84%, 'Q': 1.96%, 'E': 3.92%, 'G': 5.88%, 'H': 1.96%, 'I': 3.92%, 'L': 3.92%, 'K': 11.76%, 'M': 1.96%, 'F': 5.88%, 'P': 1.96%, 'S': 9.8%, 'T': 1.96%, 'W': 1.96%, 'Y': 1.96%, 'V': 3.92%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, M, P, Q, T, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5978.01 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	49.804	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	64.894	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.8	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.832	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.309	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.842	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.216, 0.216, 0.176 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.098	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7240	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.viridans (Gram-positive), B.megaterium, E.coli (Gram-negative), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Pan W, Liu X, Ge F, et al. Perinerin, a novel antimicrobial peptide purified from the clamworm Perinereis aibuhitensis grube and its partial characterization. J Biochem. 2004;135(3):297-304. Published 2004 Mar. doi:10.1093/jb/mvh036

PMID: 15113828

5.2 Protein Sequence Databases

UniProt: P84117

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P84117

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download