AMPDB_35117 | Thaumatin-like protein

PEPTIDE SUMMARY

Thaumatin-like protein

1 General Description

AMPDB ID: AMPDB_35117

Protein Names: Thaumatin-like protein

Protein Family: Thaumatin family

Gene Name: Nil

Source Organism: Phaseolus vulgaris (Kidney bean) (French bean)

Protein Length: 30 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ANFEIVNNCPYTVWAAASPGGGRRLDRGQT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 3, 'N': 3, 'D': 1, 'C': 1, 'Q': 1, 'E': 1, 'G': 4, 'H': 0, 'I': 1, 'L': 1, 'K': 0, 'M': 0, 'F': 1, 'P': 2, 'S': 1, 'T': 2, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 13.33%, 'R': 10%, 'N': 10%, 'D': 3.33%, 'C': 3.33%, 'Q': 3.33%, 'E': 3.33%, 'G': 13.33%, 'H': 0%, 'I': 3.33%, 'L': 3.33%, 'K': 0%, 'M': 0%, 'F': 3.33%, 'P': 6.67%, 'S': 3.33%, 'T': 6.67%, 'W': 3.33%, 'Y': 3.33%, 'V': 6.67%

Missing Amino Acid(s)

H, K, M

Most Occurring Amino Acid(s)

A, G

Less Occurring Amino Acid(s)

C, D, E, F, I, L, Q, S, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3221.56 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	58.667	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.49	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.483	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.613	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.527	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.937	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.233, 0.333, 0.2 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.1	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.comatus, F.oxysporum

4.2 Antimicrobial Activity

Antimicrobial, Fungicide

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ye XY, Wang HX, Ng TB, et al. First chromatographic isolation of an antifungal thaumatin-like protein from French bean legumes and demonstration of its antifungal activity. Biochem Biophys Res Commun. 1999;263(1):130-4. Published 1999 Sep 16. doi:10.1006/bbrc.1999.1166

PMID: 10486265

5.2 Protein Sequence Databases

UniProt: P83959

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83959

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 3885.XP_007158474.1

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037176, IPR001938

PANTHER: Not found

PROSITE: PS51367

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download