AMPDB_35111 | Dermaseptin-DI3
PEPTIDE SUMMARY
Dermaseptin-DI3
1 General Description
AMPDB ID: AMPDB_35111
Protein Names: Dermaseptin-DI3 (DRS-DI3) (Dermadistinctin-M) (DD M)
Protein Family: Frog skin active peptide (FSAP) family; Dermaseptin subfamily
Gene Name: Nil
Protein Length: 31 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
ALWKTMLKKLGTMALHAGKAAFGAAADTISQ
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 8, 'R': 0, 'N': 0, 'D': 1, 'C': 0, 'Q': 1, 'E': 0, 'G': 3, 'H': 1, 'I': 1, 'L': 4, 'K': 4, 'M': 2, 'F': 1, 'P': 0, 'S': 1, 'T': 3, 'W': 1, 'Y': 0, 'V': 0
Frequencies of Amino Acids
'A': 25.81%, 'R': 0%, 'N': 0%, 'D': 3.23%, 'C': 0%, 'Q': 3.23%, 'E': 0%, 'G': 9.68%, 'H': 3.23%, 'I': 3.23%, 'L': 12.9%, 'K': 12.9%, 'M': 6.45%, 'F': 3.23%, 'P': 0%, 'S': 3.23%, 'T': 9.68%, 'W': 3.23%, 'Y': 0%, 'V': 0%
Missing Amino Acid(s)
C, E, N, P, R, V, Y
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
D, F, H, I, Q, S, W
Hydrophobic Amino Acid(s) Count
20
Hydrophilic Amino Acid(s) Count
11
Basic Amino Acid(s) Count
1
Acidic Amino Acid(s) Count
5
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 3202.82 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 88.71 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 6.229 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.319 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.509 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.803 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 3.088 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.226, 0.129, 0.452 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.065 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 5500, 5500 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.faecalis (Gram-positive), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Batista CV, da Silva LR, Sebben A, et al. Antimicrobial peptides from the Brazilian frog Phyllomedusa distincta. Peptides. 1999;20(6):679-86. Published 1999. doi:10.1016/s0196-9781(99)00050-9
PMID: 10477123
Citation 2: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017
PMID: 18644413
5.2 Protein Sequence Databases
UniProt: P83640
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P83640
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR022731
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India