AMPDB_35104 | Cicadin

PEPTIDE SUMMARY

Cicadin

1 General Description

AMPDB ID: AMPDB_35104

Protein Names: Cicadin

Protein Family: Nil

Gene Name: Nil

Source Organism: Cicada flammata

Protein Length: 55 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 9, 'D': 9, 'C': 0, 'Q': 2, 'E': 3, 'G': 2, 'H': 1, 'I': 0, 'L': 0, 'K': 6, 'M': 0, 'F': 3, 'P': 1, 'S': 0, 'T': 0, 'W': 0, 'Y': 4, 'V': 6

Frequencies of Amino Acids

'A': 7.27%, 'R': 9.09%, 'N': 16.36%, 'D': 16.36%, 'C': 0%, 'Q': 3.64%, 'E': 5.45%, 'G': 3.64%, 'H': 1.82%, 'I': 0%, 'L': 0%, 'K': 10.91%, 'M': 0%, 'F': 5.45%, 'P': 1.82%, 'S': 0%, 'T': 0%, 'W': 0%, 'Y': 7.27%, 'V': 10.91%

Missing Amino Acid(s)

C, I, L, M, S, T, W

Most Occurring Amino Acid(s)

D, N

Less Occurring Amino Acid(s)

H, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6596.04 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	38.909	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.044	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.753	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.538	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.812	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.907	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.236, 0.218, 0.127 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.127	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 5960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cinerea, F.oxysporum, R.solani

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-HIV

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang H, Ng TB, Ng TB. Isolation of cicadin, a novel and potent antifungal peptide from dried juvenile cicadas. Peptides. 2002;23(1):7-11. Published 2002 Jan. doi:10.1016/s0196-9781(01)00573-3

PMID: 11814612

5.2 Protein Sequence Databases

UniProt: P83282

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83282

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR023112

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download