AMPDB_3510 | Clavanin-C

PEPTIDE SUMMARY

Clavanin-C

1 General Description

AMPDB ID: AMPDB_3510

Protein Names: Clavanin-C

Protein Family: Nil

Gene Name: Nil

Source Organism: Styela clava (Sea squirt)

Protein Length: 80 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTTILILLILGLGINAKSLEERKSEEEKVFHLLGKIIHHVGNFVYGFSHVFGDDQQDNGKFYGHYAEDNGKHWYDTGDQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 1, 'N': 4, 'D': 6, 'C': 0, 'Q': 3, 'E': 6, 'G': 10, 'H': 6, 'I': 6, 'L': 8, 'K': 7, 'M': 1, 'F': 5, 'P': 0, 'S': 3, 'T': 3, 'W': 1, 'Y': 4, 'V': 4

Frequencies of Amino Acids

'A': 2.5%, 'R': 1.25%, 'N': 5%, 'D': 7.5%, 'C': 0%, 'Q': 3.75%, 'E': 7.5%, 'G': 12.5%, 'H': 7.5%, 'I': 7.5%, 'L': 10%, 'K': 8.75%, 'M': 1.25%, 'F': 6.25%, 'P': 0%, 'S': 3.75%, 'T': 3.75%, 'W': 1.25%, 'Y': 5%, 'V': 5%

Missing Amino Acid(s)

C, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9164.28 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.25	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.491	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.48	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.661	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.222	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.449	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.35, 0.213, 0.213 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.125	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11460, 11460	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), L.monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhao C, Liaw L, Lee IH, et al. cDNA cloning of Clavanins: antimicrobial peptides of tunicate hemocytes. FEBS Lett. 1997;410(2-3):490-2. Published 1997 Jun 30. doi:10.1016/s0014-5793(97)00646-7

PMID: 9237689

Citation 2: Lee IH, Zhao C, Cho Y, et al. Clavanins, alpha-helical antimicrobial peptides from tunicate hemocytes. FEBS Lett. 1997;400(2):158-62. Published 1997 Jan 3. doi:10.1016/s0014-5793(96)01374-9

PMID: 9001389

5.2 Protein Sequence Databases

UniProt: O18493

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O18493

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Y11017	GenBank \|\| EMBL
2.	Y10406	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008453

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download