AMPDB_3505 | Defensin-2

PEPTIDE SUMMARY

Defensin-2

1 General Description

AMPDB ID: AMPDB_3505

Protein Names: Defensin-2

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: SMD2

Source Organism: Stomoxys calcitrans (Stable fly) (Conops calcitrans)

Protein Length: 97 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKFFSLFPVIVVVVACLTMRANAAPSAGNEVDHHPDYVDGVEALRQLEPELHGRYKRATCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCRK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 6, 'N': 5, 'D': 6, 'C': 7, 'Q': 1, 'E': 4, 'G': 6, 'H': 5, 'I': 1, 'L': 10, 'K': 4, 'M': 3, 'F': 3, 'P': 4, 'S': 5, 'T': 2, 'W': 1, 'Y': 2, 'V': 11

Frequencies of Amino Acids

'A': 11.34%, 'R': 6.19%, 'N': 5.15%, 'D': 6.19%, 'C': 7.22%, 'Q': 1.03%, 'E': 4.12%, 'G': 6.19%, 'H': 5.15%, 'I': 1.03%, 'L': 10.31%, 'K': 4.12%, 'M': 3.09%, 'F': 3.09%, 'P': 4.12%, 'S': 5.15%, 'T': 2.06%, 'W': 1.03%, 'Y': 2.06%, 'V': 11.34%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

A, V

Less Occurring Amino Acid(s)

I, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10614.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	88.454	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.434	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.08	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.55	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.393	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.026	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.289, 0.206, 0.289 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.062	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lehane MJ, Wu D, Lehane SM, et al. Midgut-specific immune molecules are produced by the blood-sucking insect Stomoxys calcitrans. Proc Natl Acad Sci U S A. 1997;94(21):11502-7. Published 1997 Oct 14. doi:10.1073/pnas.94.21.11502

PMID: 9326639

5.2 Protein Sequence Databases

UniProt: O16137

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O16137

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF013147	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001298182.1

5.5 Protein-Protein Interaction Databases

STRING: 35570.O16137

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download