AMPDB_35019 | Hadrurin
PEPTIDE SUMMARY
Hadrurin
1 General Description
AMPDB ID: AMPDB_35019
Protein Names: Hadrurin (Non-disulfide-bridged peptide 2.1) (NDBP-2.1) (Non-disulfide-bridged peptide 3.1) (NDBP-3.1)
Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Long chain multifunctional peptide (group 2) family
Gene Name: Nil
Protein Length: 41 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 1, 'N': 3, 'D': 2, 'C': 0, 'Q': 2, 'E': 0, 'G': 3, 'H': 0, 'I': 4, 'L': 3, 'K': 6, 'M': 0, 'F': 0, 'P': 1, 'S': 4, 'T': 2, 'W': 2, 'Y': 0, 'V': 4
Frequencies of Amino Acids
'A': 9.76%, 'R': 2.44%, 'N': 7.32%, 'D': 4.88%, 'C': 0%, 'Q': 4.88%, 'E': 0%, 'G': 7.32%, 'H': 0%, 'I': 9.76%, 'L': 7.32%, 'K': 14.63%, 'M': 0%, 'F': 0%, 'P': 2.44%, 'S': 9.76%, 'T': 4.88%, 'W': 4.88%, 'Y': 0%, 'V': 9.76%
Missing Amino Acid(s)
C, E, F, H, M, Y
Most Occurring Amino Acid(s)
K
Less Occurring Amino Acid(s)
P, R
Hydrophobic Amino Acid(s) Count
21
Hydrophilic Amino Acid(s) Count
20
Basic Amino Acid(s) Count
2
Acidic Amino Acid(s) Count
7
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 4436.18 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 104.634 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 28.542 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.2 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.626 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 11.09 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 4.997 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.317, 0.268, 0.171 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.049 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 11000, 11000 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.cloacae (Gram-negative), E.coli (Gram-negative), K.pneumoniae (Gram-negative), P.aeruginosa (Gram-negative), S.typhimurium
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Torres-Larios A, Gurrola GB, Zamudio FZ, et al. Hadrurin, a new antimicrobial peptide from the venom of the scorpion Hadrurus aztecus. Eur J Biochem. 2000;267(16):5023-31. Published 2000 Aug. doi:10.1046/j.1432-1327.2000.01556.x
PMID: 10931184
Citation 2: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899
PMID: 16036557
Citation 3: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021
PMID: 24184590
5.2 Protein Sequence Databases
UniProt: P82656
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P82656
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012526
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India