AMPDB_34933 | Skin peptide tyrosine-tyrosine

PEPTIDE SUMMARY

Skin peptide tyrosine-tyrosine

1 General Description

AMPDB ID: AMPDB_34933

Protein Names: Skin peptide tyrosine-tyrosine (SPYY) (Skin-PYY)

Protein Family: NPY family

Gene Name: Nil

Source Organism: Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

Protein Length: 36 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 3, 'N': 2, 'D': 1, 'C': 0, 'Q': 1, 'E': 4, 'G': 1, 'H': 1, 'I': 1, 'L': 3, 'K': 2, 'M': 1, 'F': 0, 'P': 5, 'S': 2, 'T': 2, 'W': 0, 'Y': 4, 'V': 1

Frequencies of Amino Acids

'A': 5.56%, 'R': 8.33%, 'N': 5.56%, 'D': 2.78%, 'C': 0%, 'Q': 2.78%, 'E': 11.11%, 'G': 2.78%, 'H': 2.78%, 'I': 2.78%, 'L': 8.33%, 'K': 5.56%, 'M': 2.78%, 'F': 0%, 'P': 13.89%, 'S': 5.56%, 'T': 5.56%, 'W': 0%, 'Y': 11.11%, 'V': 2.78%

Missing Amino Acid(s)

C, F, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, G, H, I, M, Q, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4264.78 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	56.944	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	98.514	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.208	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.705	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.522	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.092	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.278, 0.278 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.111	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 5960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Mor A, Chartrel N, Vaudry H, et al. Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity. Proc Natl Acad Sci U S A. 1994;91(22):10295-9. Published 1994 Oct 25. doi:10.1073/pnas.91.22.10295

PMID: 7937944

Citation 2: Vouldoukis I, Shai Y, Nicolas P, et al. Broad spectrum antibiotic activity of the skin-PYY. FEBS Lett. 1996;380(3):237-40. Published 1996 Feb 19. doi:10.1016/0014-5793(96)00050-6

PMID: 8601432

5.2 Protein Sequence Databases

UniProt: P80952

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P80952

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001955, IPR020392

PANTHER: PTHR10533

PROSITE: PS00265, PS50276

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download