AMPDB_34924 | Bacteriocin curvaticin FS47
PEPTIDE SUMMARY
Bacteriocin curvaticin FS47
1 General Description
AMPDB ID: AMPDB_34924
Protein Names: Bacteriocin curvaticin FS47
Protein Family: Nil
Gene Name: Nil
Protein Length: 38 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
YTAKQCLQAIGSCGIAGTGAGAAGGPAGAFVGAXVVXI
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 9, 'R': 0, 'N': 0, 'D': 0, 'C': 2, 'Q': 2, 'E': 0, 'G': 9, 'H': 0, 'I': 3, 'L': 1, 'K': 1, 'M': 0, 'F': 1, 'P': 1, 'S': 1, 'T': 2, 'W': 0, 'Y': 1, 'V': 3
Frequencies of Amino Acids
'A': 23.68%, 'R': 0%, 'N': 0%, 'D': 0%, 'C': 5.26%, 'Q': 5.26%, 'E': 0%, 'G': 23.68%, 'H': 0%, 'I': 7.89%, 'L': 2.63%, 'K': 2.63%, 'M': 0%, 'F': 2.63%, 'P': 2.63%, 'S': 2.63%, 'T': 5.26%, 'W': 0%, 'Y': 2.63%, 'V': 7.89%
Missing Amino Acid(s)
D, E, H, M, N, R, W
Most Occurring Amino Acid(s)
A, G
Less Occurring Amino Acid(s)
F, K, L, P, S, Y
Hydrophobic Amino Acid(s) Count
27
Hydrophilic Amino Acid(s) Count
9
Basic Amino Acid(s) Count
0
Acidic Amino Acid(s) Count
1
Modified Amino Acid(s) Count
{'X': 2}
Modified Amino Acid(s) Frequencies
{'X': 0.05263157894736842}
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 3208.7 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 87.632 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 24.418 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.903 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.46 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.221 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.873 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.237, 0.289, 0.263 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.053 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1615 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Enterococcus (Gram-positive), Listeria monocytogenes (Gram-positive), Pediococcus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Garver KI, Muriana PM, Muriana PM. Purification and partial amino acid sequence of curvaticin FS47, a heat-stable bacteriocin produced by Lactobacillus curvatus FS47. Appl Environ Microbiol. 1994;60(6):2191-5. Published 1994 Jun. doi:10.1128/aem.60.6.2191-2195.1994
PMID: 8031103
5.2 Protein Sequence Databases
UniProt: P80323
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P80323
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India