AMPDB_34917 | Coleoptericin

PEPTIDE SUMMARY

Coleoptericin

1 General Description

AMPDB ID: AMPDB_34917

Protein Names: Coleoptericin

Protein Family: Coleoptericin family

Gene Name: Nil

Source Organism: Zophobas atratus (Giant mealworm beetle) (Zophobas rugipes)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

SLQGGAPNFPQPSQQNGGWQVSPDLGRDDKGNTRGQIEIQNKGKDHDFNAGWGKVIRGPNKAKPTWHVGGTYRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 5, 'N': 6, 'D': 5, 'C': 0, 'Q': 7, 'E': 1, 'G': 13, 'H': 2, 'I': 3, 'L': 2, 'K': 6, 'M': 0, 'F': 2, 'P': 6, 'S': 3, 'T': 3, 'W': 3, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 4.05%, 'R': 6.76%, 'N': 8.11%, 'D': 6.76%, 'C': 0%, 'Q': 9.46%, 'E': 1.35%, 'G': 17.57%, 'H': 2.7%, 'I': 4.05%, 'L': 2.7%, 'K': 8.11%, 'M': 0%, 'F': 2.7%, 'P': 8.11%, 'S': 4.05%, 'T': 4.05%, 'W': 4.05%, 'Y': 1.35%, 'V': 4.05%

Missing Amino Acid(s)

C, M

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8109.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	42.162	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	43.876	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.316	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.678	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.819	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.181	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.189, 0.378, 0.081 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.081	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17990, 17990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Bulet P, Cociancich S, Dimarcq JL, et al. Insect immunity. Isolation from a coleopteran insect of a novel inducible antibacterial peptide and of new members of the insect defensin family. J Biol Chem. 1991;266(36):24520-5. Published 1991 Dec 25. doi:

PMID: 1761552

5.2 Protein Sequence Databases

UniProt: P80032

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P80032

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR009382

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download