AMPDB_34897 | Bacteriocin sublancin-168

PEPTIDE SUMMARY

Bacteriocin sublancin-168

1 General Description

AMPDB ID: AMPDB_34897

Protein Names: Bacteriocin sublancin-168

Protein Family: Nil

Gene Name: sunA SPBc2p020

Source Organism: Bacillus phage SPbeta (Bacillus phage SPBc2) (Bacteriophage SP-beta)

Protein Length: 56 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 2, 'N': 2, 'D': 0, 'C': 5, 'Q': 5, 'E': 5, 'G': 9, 'H': 0, 'I': 1, 'L': 6, 'K': 5, 'M': 1, 'F': 2, 'P': 0, 'S': 2, 'T': 1, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 10.71%, 'R': 3.57%, 'N': 3.57%, 'D': 0%, 'C': 8.93%, 'Q': 8.93%, 'E': 8.93%, 'G': 16.07%, 'H': 0%, 'I': 1.79%, 'L': 10.71%, 'K': 8.93%, 'M': 1.79%, 'F': 3.57%, 'P': 0%, 'S': 3.57%, 'T': 1.79%, 'W': 1.79%, 'Y': 1.79%, 'V': 3.57%

Missing Amino Acid(s)

D, H, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, M, T, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5981.91 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	69.821	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	23.746	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.216	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.644	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.207	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.695	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.232, 0.232, 0.321 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.071	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7240	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), B.subtilis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lazarevic V, DÃ¼sterhÃ¶ft A, Soldo B, et al. Nucleotide sequence of the Bacillus subtilis temperate bacteriophage SPbetac2. Microbiology (Reading). 1999;145 ( Pt 5):1055-1067. Published 1999 May. doi:10.1099/13500872-145-5-1055

PMID: 10376821

5.2 Protein Sequence Databases

UniProt: P68578

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P68578

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF020713	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_046571.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR026479

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: vg:1261375

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download