AMPDB_34890 | Antimicrobial peptide eNAP-2

PEPTIDE SUMMARY

Antimicrobial peptide eNAP-2

1 General Description

AMPDB ID: AMPDB_34890

Protein Names: Antimicrobial peptide eNAP-2

Protein Family: Nil

Gene Name: Nil

Source Organism: Equus caballus (Horse)

Protein Length: 46 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 3, 'N': 1, 'D': 1, 'C': 6, 'Q': 1, 'E': 3, 'G': 7, 'H': 2, 'I': 0, 'L': 2, 'K': 3, 'M': 0, 'F': 1, 'P': 6, 'S': 3, 'T': 3, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 4.35%, 'R': 6.52%, 'N': 2.17%, 'D': 2.17%, 'C': 13.04%, 'Q': 2.17%, 'E': 6.52%, 'G': 15.22%, 'H': 4.35%, 'I': 0%, 'L': 4.35%, 'K': 6.52%, 'M': 0%, 'F': 2.17%, 'P': 13.04%, 'S': 6.52%, 'T': 6.52%, 'W': 0%, 'Y': 0%, 'V': 4.35%

Missing Amino Acid(s)

I, M, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, N, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4769.42 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	33.913	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	59.12	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.698	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.464	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.128	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.813	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.109, 0.37, 0.152 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.022	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 375	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Couto MA, Harwig SS, Cullor JS, et al. eNAP-2, a novel cysteine-rich bactericidal peptide from equine leukocytes. Infect Immun. 1992;60(12):5042-7. Published 1992 Dec. doi:10.1128/iai.60.12.5042-5047.1992

PMID: 1452336

Citation 2: Couto MA, Harwig SS, Lehrer RI, et al. Selective inhibition of microbial serine proteases by eNAP-2, an antimicrobial peptide from equine neutrophils. Infect Immun. 1993;61(7):2991-4. Published 1993 Jul. doi:10.1128/iai.61.7.2991-2994.1993

PMID: 8514405

5.2 Protein Sequence Databases

UniProt: P56928

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P56928

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036645

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download