AMPDB_34874 | Antibacterial peptide PMAP-37

PEPTIDE SUMMARY

Antibacterial peptide PMAP-37

1 General Description

AMPDB ID: AMPDB_34874

Protein Names: Antibacterial peptide PMAP-37 (Myeloid antibacterial peptide 37)

Protein Family: Cathelicidin family

Gene Name: PMAP37

Source Organism: Sus scrofa (Pig)

Protein Length: 167 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

METQRASLCLGRWSLWLLLLALVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTWRPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEIQSVGLLSRLRDFLSDRGRRLGEKIERIGQKIKDLSEFFQS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 15, 'N': 4, 'D': 11, 'C': 5, 'Q': 9, 'E': 13, 'G': 8, 'H': 0, 'I': 6, 'L': 24, 'K': 9, 'M': 1, 'F': 5, 'P': 11, 'S': 13, 'T': 8, 'W': 3, 'Y': 2, 'V': 11

Frequencies of Amino Acids

'A': 5.39%, 'R': 8.98%, 'N': 2.4%, 'D': 6.59%, 'C': 2.99%, 'Q': 5.39%, 'E': 7.78%, 'G': 4.79%, 'H': 0%, 'I': 3.59%, 'L': 14.37%, 'K': 5.39%, 'M': 0.6%, 'F': 2.99%, 'P': 6.59%, 'S': 7.78%, 'T': 4.79%, 'W': 1.8%, 'Y': 1.2%, 'V': 6.59%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	18926.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	94.551	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.929	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.39	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.932	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.57	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.288	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.305, 0.216, 0.281 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.06	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19480, 19730	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tossi A, Scocchi M, Zanetti M, et al. PMAP-37, a novel antibacterial peptide from pig myeloid cells. cDNA cloning, chemical synthesis and activity. Eur J Biochem. 1995;228(3):941-6. Published 1995 Mar 15. doi:10.1111/j.1432-1033.1995.tb20344.x

PMID: 7737198

5.2 Protein Sequence Databases

UniProt: P49932

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P49932

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L39641	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 9823.ENSSSCP00000012102

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download