AMPDB_34873 | 4 kDa defensin

PEPTIDE SUMMARY

4 kDa defensin

1 General Description

AMPDB ID: AMPDB_34873

Protein Names: 4 kDa defensin (Antibacterial 4 kDa peptide)

Protein Family: Invertebrate defensin family; Type 2 subfamily

Gene Name: Nil

Source Organism: Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Protein Length: 38 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 6, 'N': 2, 'D': 0, 'C': 6, 'Q': 2, 'E': 0, 'G': 6, 'H': 2, 'I': 1, 'L': 1, 'K': 1, 'M': 0, 'F': 3, 'P': 1, 'S': 1, 'T': 2, 'W': 0, 'Y': 2, 'V': 0

Frequencies of Amino Acids

'A': 5.26%, 'R': 15.79%, 'N': 5.26%, 'D': 0%, 'C': 15.79%, 'Q': 5.26%, 'E': 0%, 'G': 15.79%, 'H': 5.26%, 'I': 2.63%, 'L': 2.63%, 'K': 2.63%, 'M': 0%, 'F': 7.89%, 'P': 2.63%, 'S': 2.63%, 'T': 5.26%, 'W': 0%, 'Y': 5.26%, 'V': 0%

Missing Amino Acid(s)

D, E, M, V, W

Most Occurring Amino Acid(s)

C, G, R

Less Occurring Amino Acid(s)

I, K, L, P, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4325.97 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	25.79	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	85.94	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.653	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.82	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.594	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.806	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.184, 0.263, 0.079 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.132	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), M.luteus (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-MRSA, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Cociancich S, Goyffon M, Bontems F, et al. Purification and characterization of a scorpion defensin, a 4kDa antibacterial peptide presenting structural similarities with insect defensins and scorpion toxins. Biochem Biophys Res Commun. 1993;194(1):17-22. Published 1993 Jul 15. doi:10.1006/bbrc.1993.1778

PMID: 8333834

5.2 Protein Sequence Databases

UniProt: P41965

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P41965

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download