AMPDB_34859 | Antifungal protein S
PEPTIDE SUMMARY
Antifungal protein S
1 General Description
AMPDB ID: AMPDB_34859
Protein Names: Antifungal protein S
Protein Family: Thaumatin family
Gene Name: Nil
Source Organism: Hordeum vulgare (Barley)
Protein Length: 37 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 6, 'R': 0, 'N': 1, 'D': 1, 'C': 1, 'Q': 3, 'E': 0, 'G': 4, 'H': 0, 'I': 2, 'L': 1, 'K': 2, 'M': 0, 'F': 1, 'P': 2, 'S': 1, 'T': 4, 'W': 2, 'Y': 1, 'V': 3
Frequencies of Amino Acids
'A': 16.22%, 'R': 0%, 'N': 2.7%, 'D': 2.7%, 'C': 2.7%, 'Q': 8.11%, 'E': 0%, 'G': 10.81%, 'H': 0%, 'I': 5.41%, 'L': 2.7%, 'K': 5.41%, 'M': 0%, 'F': 2.7%, 'P': 5.41%, 'S': 2.7%, 'T': 10.81%, 'W': 5.41%, 'Y': 2.7%, 'V': 8.11%
Missing Amino Acid(s)
E, H, M, R
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
C, D, F, L, N, S, Y
Hydrophobic Amino Acid(s) Count
21
Hydrophilic Amino Acid(s) Count
14
Basic Amino Acid(s) Count
1
Acidic Amino Acid(s) Count
2
Modified Amino Acid(s) Count
{'X': 2}
Modified Amino Acid(s) Frequencies
{'X': 0.05405405405405406}
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 3651.15 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 71.351 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 19.757 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.127 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.357 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.519 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.935 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.27, 0.216, 0.189 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.108 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 12490, 12490 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Candida, Trichoderma
4.2 Antimicrobial Activity
Antimicrobial, Fungicide, Plant defense, Anti-candida
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Hejgaard J, Jacobsen S, Svendsen I, et al. Two antifungal thaumatin-like proteins from barley grain. FEBS Lett. 1991;291(1):127-31. Published 1991 Oct 7. doi:10.1016/0014-5793(91)81119-s
PMID: 1936240
5.2 Protein Sequence Databases
UniProt: P33045
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P33045
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR037176, IPR001938
PANTHER: Not found
PROSITE: PS51367
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India