AMPDB_34858 | Antifungal protein R

PEPTIDE SUMMARY

Antifungal protein R

1 General Description

AMPDB ID: AMPDB_34858

Protein Names: Antifungal protein R

Protein Family: Thaumatin family

Gene Name: Nil

Source Organism: Hordeum vulgare (Barley)

Protein Length: 44 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ATITVVNRCSYTVWPGALPGGGVRLDPGQRWALNMPAGTAGAAV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 3, 'N': 2, 'D': 1, 'C': 1, 'Q': 1, 'E': 0, 'G': 7, 'H': 0, 'I': 1, 'L': 3, 'K': 0, 'M': 1, 'F': 0, 'P': 4, 'S': 1, 'T': 4, 'W': 2, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 15.91%, 'R': 6.82%, 'N': 4.55%, 'D': 2.27%, 'C': 2.27%, 'Q': 2.27%, 'E': 0%, 'G': 15.91%, 'H': 0%, 'I': 2.27%, 'L': 6.82%, 'K': 0%, 'M': 2.27%, 'F': 0%, 'P': 9.09%, 'S': 2.27%, 'T': 9.09%, 'W': 4.55%, 'Y': 2.27%, 'V': 11.36%

Missing Amino Acid(s)

E, F, H, K

Most Occurring Amino Acid(s)

A, G

Less Occurring Amino Acid(s)

C, D, I, M, Q, S, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4453.12 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	84.318	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.007	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.239	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.508	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.499	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.936	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.273, 0.318, 0.25 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.068	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Candida, Trichoderma

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense, Anti-candida

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hejgaard J, Jacobsen S, Svendsen I, et al. Two antifungal thaumatin-like proteins from barley grain. FEBS Lett. 1991;291(1):127-31. Published 1991 Oct 7. doi:10.1016/0014-5793(91)81119-s

PMID: 1936240

5.2 Protein Sequence Databases

UniProt: P33044

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P33044

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037176, IPR001938

PANTHER: PTHR31048

PROSITE: PS51367

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download