AMPDB_34832 | Colicin-E5

PEPTIDE SUMMARY

Colicin-E5

1 General Description

AMPDB ID: AMPDB_34832

Protein Names: Colicin-E5 (EC 3.1.-.-)

Protein Family: Colicin pyosin nuclease family

Gene Name: col

Source Organism: Escherichia coli

Protein Length: 180 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

RFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKADADAALSTAMESRKKKEDNKRDAEGKLNDELAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 19, 'R': 11, 'N': 11, 'D': 20, 'C': 0, 'Q': 9, 'E': 8, 'G': 16, 'H': 2, 'I': 6, 'L': 6, 'K': 21, 'M': 5, 'F': 3, 'P': 9, 'S': 8, 'T': 11, 'W': 4, 'Y': 3, 'V': 8

Frequencies of Amino Acids

'A': 10.56%, 'R': 6.11%, 'N': 6.11%, 'D': 11.11%, 'C': 0%, 'Q': 5%, 'E': 4.44%, 'G': 8.89%, 'H': 1.11%, 'I': 3.33%, 'L': 3.33%, 'K': 11.67%, 'M': 2.78%, 'F': 1.67%, 'P': 5%, 'S': 4.44%, 'T': 6.11%, 'W': 2.22%, 'Y': 1.67%, 'V': 4.44%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

104

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19874 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	49.444	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.499	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.182	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.489	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.822	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.194	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.167, 0.244, 0.211 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	26470, 26470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lau PC, Condie JA, Condie JA. Nucleotide sequences from the colicin E5, E6 and E9 operons: presence of a degenerate transposon-like structure in the ColE9-J plasmid. Mol Gen Genet. 1989;217(2-3):269-77. Published 1989 Jun. doi:10.1007/BF02464892

PMID: 2549375

Citation 2: Curtis MD, James R, Coddington A, et al. An evolutionary relationship between the ColE5-099 and the ColE9-J plasmids revealed by nucleotide sequencing. J Gen Microbiol. 1989;135(10):2783-8. Published 1989 Oct. doi:10.1099/00221287-135-10-2783

PMID: 2561131

5.2 Protein Sequence Databases

UniProt: P18000

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P18000

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X15857	GenBank \|\| EMBL
2.	M30445	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR038233, IPR021964, IPR038234

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download