AMPDB_34762 | Antimicrobial peptide 143
PEPTIDE SUMMARY
Antimicrobial peptide 143
1 General Description
AMPDB ID: AMPDB_34762
Protein Names: Antimicrobial peptide 143
Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family
Gene Name: Nil
Protein Length: 73 AA
Protein Existence: Inferred from homology
2 Protein Sequence & Composition
2.1 Sequence
MKVKCLLAVFLIVLIAAEHCQALFFLPSLIGGLISAIKGRRKRELGTQFRPQQKNFMRREIDLERLFAEMPDY
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 6, 'R': 7, 'N': 1, 'D': 2, 'C': 2, 'Q': 4, 'E': 5, 'G': 4, 'H': 1, 'I': 6, 'L': 11, 'K': 5, 'M': 3, 'F': 6, 'P': 3, 'S': 2, 'T': 1, 'W': 0, 'Y': 1, 'V': 3
Frequencies of Amino Acids
'A': 8.22%, 'R': 9.59%, 'N': 1.37%, 'D': 2.74%, 'C': 2.74%, 'Q': 5.48%, 'E': 6.85%, 'G': 5.48%, 'H': 1.37%, 'I': 8.22%, 'L': 15.07%, 'K': 6.85%, 'M': 4.11%, 'F': 8.22%, 'P': 4.11%, 'S': 2.74%, 'T': 1.37%, 'W': 0%, 'Y': 1.37%, 'V': 4.11%
Missing Amino Acid(s)
W
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
H, N, T, Y
Hydrophobic Amino Acid(s) Count
42
Hydrophilic Amino Acid(s) Count
31
Basic Amino Acid(s) Count
7
Acidic Amino Acid(s) Count
13
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8480.21 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 110.959 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 41.734 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.185 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.62 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.366 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 4.972 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.37, 0.137, 0.342 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.096 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1615 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Ruiming Z, Yibao M, Yawen H, et al. Comparative venom gland transcriptome analysis of the scorpion Lychas mucronatus reveals intraspecific toxic gene diversity and new venomous components. BMC Genomics. 2010;11:452. Published 2010 Jul 28. doi:10.1186/1471-2164-11-452
PMID: 20663230
5.2 Protein Sequence Databases
UniProt: P0CI90
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P0CI90
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. GT029142 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India