AMPDB_34716 | Lantibiotic streptin

PEPTIDE SUMMARY

Lantibiotic streptin

1 General Description

AMPDB ID: AMPDB_34716

Protein Names: Lantibiotic streptin

Protein Family: Type A lantibiotic family

Gene Name: srtA

Source Organism: Streptococcus pyogenes

Protein Length: 46 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 1, 'N': 3, 'D': 4, 'C': 3, 'Q': 0, 'E': 0, 'G': 2, 'H': 0, 'I': 1, 'L': 4, 'K': 6, 'M': 1, 'F': 2, 'P': 2, 'S': 2, 'T': 8, 'W': 1, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 2.17%, 'R': 2.17%, 'N': 6.52%, 'D': 8.7%, 'C': 6.52%, 'Q': 0%, 'E': 0%, 'G': 4.35%, 'H': 0%, 'I': 2.17%, 'L': 8.7%, 'K': 13.04%, 'M': 2.17%, 'F': 4.35%, 'P': 4.35%, 'S': 4.35%, 'T': 17.39%, 'W': 2.17%, 'Y': 4.35%, 'V': 6.52%

Missing Amino Acid(s)

E, H, Q

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, I, M, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5219.05 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	63.478	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.454	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.391	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.464	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.898	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.81	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.283, 0.196, 0.13 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.109	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8605	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Karaya K, Shimizu T, Taketo A, et al. New gene cluster for lantibiotic streptin possibly involved in streptolysin S formation. J Biochem. 2001;129(5):769-75. Published 2001 May. doi:10.1093/oxfordjournals.jbchem.a002918

PMID: 11328600

Citation 2: Wescombe PA, Tagg JR, Tagg JR. Purification and characterization of streptin, a type A1 lantibiotic produced by Streptococcus pyogenes. Appl Environ Microbiol. 2003;69(5):2737-47. Published 2003 May. doi:10.1128/AEM.69.5.2737-2747.2003

PMID: 12732544

5.2 Protein Sequence Databases

UniProt: P0C0H8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0C0H8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB030831	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_002984803.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download