AMPDB_34701 | Defensin gallicin
PEPTIDE SUMMARY
Defensin gallicin
1 General Description
AMPDB ID: AMPDB_34701
Protein Names: Defensin gallicin
Protein Family: Nil
Gene Name: Nil
Protein Length: 68 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MWIESDAGVAIDRHARGACSLGEAGCATYCFYQGKHHGGCCGENYTKCLGTCYCNGSGYEYRCHSCDL
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 6, 'R': 3, 'N': 2, 'D': 3, 'C': 10, 'Q': 1, 'E': 4, 'G': 11, 'H': 4, 'I': 2, 'L': 3, 'K': 2, 'M': 1, 'F': 1, 'P': 0, 'S': 4, 'T': 3, 'W': 1, 'Y': 6, 'V': 1
Frequencies of Amino Acids
'A': 8.82%, 'R': 4.41%, 'N': 2.94%, 'D': 4.41%, 'C': 14.71%, 'Q': 1.47%, 'E': 5.88%, 'G': 16.18%, 'H': 5.88%, 'I': 2.94%, 'L': 4.41%, 'K': 2.94%, 'M': 1.47%, 'F': 1.47%, 'P': 0%, 'S': 5.88%, 'T': 4.41%, 'W': 1.47%, 'Y': 8.82%, 'V': 1.47%
Missing Amino Acid(s)
P
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
F, M, Q, V, W
Hydrophobic Amino Acid(s) Count
26
Hydrophilic Amino Acid(s) Count
42
Basic Amino Acid(s) Count
7
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7355.18 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 41.765 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 32.154 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.329 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.659 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.468 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -2.255 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.206, 0.25, 0.206 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.118 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 14440, 15065 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Venier P, De Pittà C, Pallavicini A, et al. Development of mussel mRNA profiling: Can gene expression trends reveal coastal water pollution? Mutat Res. 2006;602(1-2):121-34. Published 2006 Dec 1. doi:10.1016/j.mrfmmm.2006.08.007
PMID: 17010391
Citation 2: Schneider T, Kruse T, Wimmer R, et al. Plectasin, a fungal defensin, targets the bacterial cell wall precursor Lipid II. Science. 2010;328(5982):1168-72. Published 2010 May 28. doi:10.1126/science.1185723
PMID: 20508130
5.2 Protein Sequence Databases
UniProt: P00000
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P00000
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AJ624472 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India