AMPDB_34700 | Clavaspirin
PEPTIDE SUMMARY
Clavaspirin
1 General Description
AMPDB ID: AMPDB_34700
Protein Names: Clavaspirin
Protein Family: Nil
Gene Name: Nil
Source Organism: Styela clava (Sea squirt)
Protein Length: 80 AA
Protein Existence: Evidence at transcript level
2 Protein Sequence & Composition
2.1 Sequence
MKTIILILLILGLGIDAKSLEESKADEEKFLRFIGSVIHGIGHLVHHIGVALGDDQQDNGKFYGYYAEDNGKHWYDTGDQ
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 1, 'N': 2, 'D': 8, 'C': 0, 'Q': 3, 'E': 5, 'G': 11, 'H': 5, 'I': 9, 'L': 9, 'K': 6, 'M': 1, 'F': 3, 'P': 0, 'S': 3, 'T': 2, 'W': 1, 'Y': 4, 'V': 3
Frequencies of Amino Acids
'A': 5%, 'R': 1.25%, 'N': 2.5%, 'D': 10%, 'C': 0%, 'Q': 3.75%, 'E': 6.25%, 'G': 13.75%, 'H': 6.25%, 'I': 11.25%, 'L': 11.25%, 'K': 7.5%, 'M': 1.25%, 'F': 3.75%, 'P': 0%, 'S': 3.75%, 'T': 2.5%, 'W': 1.25%, 'Y': 5%, 'V': 3.75%
Missing Amino Acid(s)
C, P
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
M, R, W
Hydrophobic Amino Acid(s) Count
41
Hydrophilic Amino Acid(s) Count
39
Basic Amino Acid(s) Count
13
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8929.08 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 103.625 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 40.075 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.205 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.751 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 5.012 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -5.54 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.363, 0.2, 0.238 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.1 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 11460, 11460 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Lee IH, Zhao C, Nguyen T, et al. Clavaspirin, an antibacterial and haemolytic peptide from Styela clava. J Pept Res. 2001;58(6):445-56. Published 2001 Dec. doi:
PMID: 12005415
5.2 Protein Sequence Databases
UniProt: O97395
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: O97395
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. Y17680 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR008453
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India