AMPDB_347 | Cathelicidin-1

PEPTIDE SUMMARY

Cathelicidin-1

1 General Description

AMPDB ID: AMPDB_347

Protein Names: Cathelicidin-1 (CATH-1) (Fowlicidin-1)

Protein Family: Cathelicidin family

Gene Name: CATHL1 CATH

Source Organism: Gallus gallus (Chicken)

Protein Length: 148 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MLSCWVLLLALLGGACALPAPLGYSQALAQAVDSYNQRPEVQNAFRLLSADPEPGPNVQLSSLHNLNFTIMETRCQARSGAQLDSCEFKEDGLVKDCAAPVVLQGGRAVLDVTCVDSMADPVRVKRVWPLVIRTVIAGYNLYRAIKKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 17, 'R': 9, 'N': 6, 'D': 8, 'C': 6, 'Q': 8, 'E': 5, 'G': 9, 'H': 1, 'I': 4, 'L': 20, 'K': 6, 'M': 3, 'F': 3, 'P': 9, 'S': 9, 'T': 4, 'W': 2, 'Y': 4, 'V': 15

Frequencies of Amino Acids

'A': 11.49%, 'R': 6.08%, 'N': 4.05%, 'D': 5.41%, 'C': 4.05%, 'Q': 5.41%, 'E': 3.38%, 'G': 6.08%, 'H': 0.68%, 'I': 2.7%, 'L': 13.51%, 'K': 4.05%, 'M': 2.03%, 'F': 2.03%, 'P': 6.08%, 'S': 6.08%, 'T': 2.7%, 'W': 1.35%, 'Y': 2.7%, 'V': 10.14%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16071.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	104.122	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.665	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.136	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.785	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.107	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.724	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.324, 0.223, 0.304 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.061	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 17335	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lynn DJ, Higgs R, Gaines S, et al. Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken. Immunogenetics. 2004;56(3):170-7. Published 2004 Jun. doi:10.1007/s00251-004-0675-0

PMID: 15148642

Citation 2: Xiao Y, Cai Y, Bommineni YR, et al. Identification and functional characterization of three chicken cathelicidins with potent antimicrobial activity. J Biol Chem. 2006;281(5):2858-67. Published 2006 Feb 3. doi:10.1074/jbc.M507180200

PMID: 16326712

Citation 3: Goitsuka R, Chen CL, Benyon L, et al. Chicken cathelicidin-B1, an antimicrobial guardian at the mucosal M cell gateway. Proc Natl Acad Sci U S A. 2007;104(38):15063-8. Published 2007 Sep 18. doi:10.1073/pnas.0707037104

PMID: 17827276

Citation 4: Xiao Y, Dai H, Bommineni YR, et al. Structure-activity relationships of fowlicidin-1, a cathelicidin antimicrobial peptide in chicken. FEBS J. 2006;273(12):2581-93. Published 2006 Jun. doi:10.1111/j.1742-4658.2006.05261.x

PMID: 16817888

5.2 Protein Sequence Databases

UniProt: Q6QLQ5

5.3 3D Structure Databases