AMPDB_34693 | Dermaseptin AA-3-4

PEPTIDE SUMMARY

Dermaseptin AA-3-4

1 General Description

AMPDB ID: AMPDB_34693

Protein Names: Dermaseptin AA-3-4

Protein Family: Frog skin active peptide (FSAP) family

Gene Name: Nil

Source Organism: Agalychnis annae (Blue-sided leaf frog) (Phyllomedusa annae)

Protein Length: 72 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSICDEEKRENEDEEEQEDDEQSEEKRGMWGSLLKGVATVVKHVLPHALSSQQS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 1, 'D': 4, 'C': 1, 'Q': 4, 'E': 11, 'G': 4, 'H': 2, 'I': 1, 'L': 11, 'K': 6, 'M': 2, 'F': 3, 'P': 1, 'S': 8, 'T': 1, 'W': 1, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 4.17%, 'R': 2.78%, 'N': 1.39%, 'D': 5.56%, 'C': 1.39%, 'Q': 5.56%, 'E': 15.28%, 'G': 5.56%, 'H': 2.78%, 'I': 1.39%, 'L': 15.28%, 'K': 8.33%, 'M': 2.78%, 'F': 4.17%, 'P': 1.39%, 'S': 11.11%, 'T': 1.39%, 'W': 1.39%, 'Y': 0%, 'V': 8.33%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

E, L

Less Occurring Amino Acid(s)

C, I, N, P, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8163.24 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	93.333	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	73.815	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.394	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.604	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.368	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.863	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.306, 0.194, 0.375 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wechselberger C, Wechselberger C. Cloning of cDNAs encoding new peptides of the dermaseptin-family. Biochim Biophys Acta. 1998;1388(1):279-83. Published 1998 Oct 14. doi:10.1016/s0167-4838(98)00202-7

PMID: 9774745

5.2 Protein Sequence Databases

UniProt: O93225

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O93225

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ005187	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download