AMPDB_34690 | Dermatoxin-A1
PEPTIDE SUMMARY
Dermatoxin-A1
1 General Description
AMPDB ID: AMPDB_34690
Protein Names: Dermatoxin-A1 (DRT-A1) (Dermaseptin AA-1-1)
Protein Family: Frog skin active peptide (FSAP) family; Dermatoxin subfamily
Gene Name: Nil
Protein Length: 77 AA
Protein Existence: Inferred from homology
2 Protein Sequence & Composition
2.1 Sequence
MAFLKKSLFLVLFLGLVPLFLCENEKREGENEKEENDDQSEEKRSLGSFMKGVGKGLATVGKIVADQFGKLLEAGQG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 2, 'N': 3, 'D': 3, 'C': 1, 'Q': 3, 'E': 10, 'G': 10, 'H': 0, 'I': 1, 'L': 12, 'K': 9, 'M': 2, 'F': 6, 'P': 1, 'S': 4, 'T': 1, 'W': 0, 'Y': 0, 'V': 5
Frequencies of Amino Acids
'A': 5.19%, 'R': 2.6%, 'N': 3.9%, 'D': 3.9%, 'C': 1.3%, 'Q': 3.9%, 'E': 12.99%, 'G': 12.99%, 'H': 0%, 'I': 1.3%, 'L': 15.58%, 'K': 11.69%, 'M': 2.6%, 'F': 7.79%, 'P': 1.3%, 'S': 5.19%, 'T': 1.3%, 'W': 0%, 'Y': 0%, 'V': 6.49%
Missing Amino Acid(s)
H, W, Y
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
C, I, P, T
Hydrophobic Amino Acid(s) Count
41
Hydrophilic Amino Acid(s) Count
36
Basic Amino Acid(s) Count
13
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8463.77 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 89.87 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 29.634 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.243 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.632 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.815 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -2.048 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.312, 0.234, 0.364 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.078 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Wechselberger C, Wechselberger C. Cloning of cDNAs encoding new peptides of the dermaseptin-family. Biochim Biophys Acta. 1998;1388(1):279-83. Published 1998 Oct 14. doi:10.1016/s0167-4838(98)00202-7
PMID: 9774745
Citation 2: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017
PMID: 18644413
5.2 Protein Sequence Databases
UniProt: O93221
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: O93221
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AJ005183 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275, IPR016322
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India