AMPDB_34675 | Styelin-C
PEPTIDE SUMMARY
Styelin-C
1 General Description
AMPDB ID: AMPDB_34675
Protein Names: Styelin-C
Protein Family: Nil
Gene Name: Nil
Source Organism: Styela clava (Sea squirt)
Protein Length: 80 AA
Protein Existence: Inferred from homology
2 Protein Sequence & Composition
2.1 Sequence
MQMKATILIVLVALFMIQQSEAGWFGKAFRSVSNFYKKHKTYIHAGLSAATLLGDMTDEEFQEFMQDIEQAREEELLSRQ
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 8, 'R': 3, 'N': 1, 'D': 3, 'C': 0, 'Q': 7, 'E': 8, 'G': 4, 'H': 2, 'I': 5, 'L': 8, 'K': 5, 'M': 5, 'F': 6, 'P': 0, 'S': 5, 'T': 4, 'W': 1, 'Y': 2, 'V': 3
Frequencies of Amino Acids
'A': 10%, 'R': 3.75%, 'N': 1.25%, 'D': 3.75%, 'C': 0%, 'Q': 8.75%, 'E': 10%, 'G': 5%, 'H': 2.5%, 'I': 6.25%, 'L': 10%, 'K': 6.25%, 'M': 6.25%, 'F': 7.5%, 'P': 0%, 'S': 6.25%, 'T': 5%, 'W': 1.25%, 'Y': 2.5%, 'V': 3.75%
Missing Amino Acid(s)
C, P
Most Occurring Amino Acid(s)
A, E, L
Less Occurring Amino Acid(s)
N, W
Hydrophobic Amino Acid(s) Count
40
Hydrophilic Amino Acid(s) Count
40
Basic Amino Acid(s) Count
11
Acidic Amino Acid(s) Count
10
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9247.65 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 84.25 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 61.711 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.145 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.769 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 5.038 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -2.808 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.313, 0.125, 0.363 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.113 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 8480, 8480 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Zhao C, Liaw L, Lee IH, et al. cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava. FEBS Lett. 1997;412(1):144-8. Published 1997 Jul 21. doi:10.1016/s0014-5793(97)00769-2
PMID: 9257708
5.2 Protein Sequence Databases
UniProt: O18494
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: O18494
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. Y13268 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR035578
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India