AMPDB_3467 | Antimicrobial peptide UyCT1

PEPTIDE SUMMARY

Antimicrobial peptide UyCT1

1 General Description

AMPDB ID: AMPDB_3467

Protein Names: Antimicrobial peptide UyCT1 (CT1) (Non-disulfide-bridged peptide 4.16) (NDBP-4.16) (Non-disulfide-bridged peptide 5.18) (NDBP-5.18) [Cleaved into: Antimicrobial peptide UyCT2 (Non-disulfide-bridged peptide 5.19) (NDBP-5.19)]

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Urodacus yaschenkoi (Inland robust scorpion)

Protein Length: 79 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKTQLAFLAITVILMQLFAQTEAGFWGKLWEGVKNAIGKRGLRNVDQIADLFDSGLSDADDLFDSGLSDADAKFMKMFM

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 2, 'N': 2, 'D': 9, 'C': 0, 'Q': 4, 'E': 2, 'G': 7, 'H': 0, 'I': 4, 'L': 10, 'K': 6, 'M': 5, 'F': 7, 'P': 0, 'S': 4, 'T': 3, 'W': 2, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 11.39%, 'R': 2.53%, 'N': 2.53%, 'D': 11.39%, 'C': 0%, 'Q': 5.06%, 'E': 2.53%, 'G': 8.86%, 'H': 0%, 'I': 5.06%, 'L': 12.66%, 'K': 7.59%, 'M': 6.33%, 'F': 8.86%, 'P': 0%, 'S': 5.06%, 'T': 3.8%, 'W': 2.53%, 'Y': 0%, 'V': 3.8%

Missing Amino Acid(s)

C, H, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, N, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8765.15 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.519	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	24.989	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.153	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.847	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.393	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.996	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.329, 0.165, 0.329 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11000, 11000	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Luna-RamÃrez K, Quintero-HernÃ¡ndez V, Vargas-Jaimes L, et al. Characterization of the venom from the Australian scorpion Urodacus yaschenkoi: Molecular mass analysis of components, cDNA sequences and peptides with antimicrobial activity. Toxicon. 2013;63:44-54. Published 2013 Mar 1. doi:10.1016/j.toxicon.2012.11.017

PMID: 23182832

Citation 2: Zeng XC, Zhou L, Shi W, et al. Three new antimicrobial peptides from the scorpion Pandinus imperator. Peptides. 2013;45:28-34. Published 2013 Jul. doi:10.1016/j.peptides.2013.03.026

PMID: 23624072

Citation 3: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: L0GCV8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: L0GCV8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JX274240	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download