AMPDB_345 | Peptide BmKn2

1 General Description

AMPDB ID: AMPDB_345

Protein Names: Peptide BmKn2 (Kn2) (Non-disulfide-bridged peptide 4.4) (NDBP-4.4) (Non-disulfide-bridged peptide 5.4) (NDBP-5.4)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Protein Length: 70 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKSQTFFLLFLVVLLLAISQSEAFIGAIANLLSKIFGKRSMRDMDTMKYLYDPSLSAADLKTLQKLMENY

FASTA format

Counts of Amino Acids

'A': 6, 'R': 2, 'N': 2, 'D': 4, 'C': 0, 'Q': 3, 'E': 2, 'G': 2, 'H': 0, 'I': 4, 'L': 13, 'K': 6, 'M': 5, 'F': 5, 'P': 1, 'S': 7, 'T': 3, 'W': 0, 'Y': 3, 'V': 2

Frequencies of Amino Acids

'A': 8.57%, 'R': 2.86%, 'N': 2.86%, 'D': 5.71%, 'C': 0%, 'Q': 4.29%, 'E': 2.86%, 'G': 2.86%, 'H': 0%, 'I': 5.71%, 'L': 18.57%, 'K': 8.57%, 'M': 7.14%, 'F': 7.14%, 'P': 1.43%, 'S': 10%, 'T': 4.29%, 'W': 0%, 'Y': 4.29%, 'V': 2.86%

Missing Amino Acid(s)

C, H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7984.52 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.571	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.376	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.36	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.638	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.605	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.999	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.386, 0.171, 0.371 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Antiviral protein, Anti-HIV, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Zeng XC, Wang SX, Zhu Y, et al. Identification and functional characterization of novel scorpion venom peptides with no disulfide bridge from Buthus martensii Karsch. Peptides. 2004;25(2):143-50. Published 2004 Feb. doi:10.1016/j.peptides.2003.12.003

PMID: 15062994

Citation 2: Chen Y, Cao L, Zhong M, et al. Anti-HIV-1 activity of a new scorpion venom peptide derivative Kn2-7. PLoS One. 2012;7(4):e34947. Published 2012. doi:10.1371/journal.pone.0034947

PMID: 22536342

Citation 3: Arpornsuwan T, Buasakul B, Jaresitthikunchai J, et al. Potent and rapid antigonococcal activity of the venom peptide BmKn2 and its derivatives against different Maldi biotype of multidrug-resistant Neisseria gonorrhoeae. Peptides. 2014;53:315-20. Published 2014 Mar. doi:10.1016/j.peptides.2013.10.020

PMID: 24184420

Citation 4: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899

PMID: 16036557

Citation 5: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q6JQN2

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY323830	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download