AMPDB_3444 | Bottromycin D
PEPTIDE SUMMARY
Bottromycin D
1 General Description
AMPDB ID: AMPDB_3444
Protein Names: Bottromycin D
Protein Family: Nil
Gene Name: bstA
Source Organism: Streptomyces sp
Protein Length: 46 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MGPAVVFDCMTADFLNDDPNNAELSSLEMEELESWGAWSDDTDQSV
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 0, 'N': 3, 'D': 7, 'C': 1, 'Q': 1, 'E': 5, 'G': 2, 'H': 0, 'I': 0, 'L': 4, 'K': 0, 'M': 3, 'F': 2, 'P': 2, 'S': 5, 'T': 2, 'W': 2, 'Y': 0, 'V': 3
Frequencies of Amino Acids
'A': 8.7%, 'R': 0%, 'N': 6.52%, 'D': 15.22%, 'C': 2.17%, 'Q': 2.17%, 'E': 10.87%, 'G': 4.35%, 'H': 0%, 'I': 0%, 'L': 8.7%, 'K': 0%, 'M': 6.52%, 'F': 4.35%, 'P': 4.35%, 'S': 10.87%, 'T': 4.35%, 'W': 4.35%, 'Y': 0%, 'V': 6.52%
Missing Amino Acid(s)
H, I, K, R, Y
Most Occurring Amino Acid(s)
D
Less Occurring Amino Acid(s)
C, Q
Hydrophobic Amino Acid(s) Count
22
Hydrophilic Amino Acid(s) Count
24
Basic Amino Acid(s) Count
12
Acidic Amino Acid(s) Count
0
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 5083.44 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 61.522 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 37.274 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.4 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.386 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 2.855 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -12.052 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.239, 0.261, 0.348 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.087 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 11000, 11000 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-MRSA, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Hou Y, Tianero MD, Kwan JC, et al. Structure and biosynthesis of the antibiotic bottromycin D. Org Lett. 2012;14(19):5050-3. Published 2012 Oct 5. doi:10.1021/ol3022758
PMID: 22984777
5.2 Protein Sequence Databases
UniProt: K4JY29
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: K4JY29
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. JX827389 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India