AMPDB_3434 | Polytheonamide B

PEPTIDE SUMMARY

Polytheonamide B

1 General Description

AMPDB ID: AMPDB_3434

Protein Names: Polytheonamide B (Proteusin)

Protein Family: Nil

Gene Name: poyA

Source Organism: Bacterium symbiont subsp. Theonella swinhoei (strain pTSMAC1)

Protein Length: 145 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MADSDNTPTSRKDFETAIIAKAWKDPEYLRRLRSNPREVLQEELEALHPGAQLPDDLGISIHEEDENHVHLVMPRHPQNVSDQTLTDDDLDQAAGGTGIGVVVAVVAGAVANTGAGVNQVAGGNINVVGNINVNANVSVNMNQTT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 6, 'N': 14, 'D': 12, 'C': 0, 'Q': 7, 'E': 9, 'G': 12, 'H': 5, 'I': 7, 'L': 10, 'K': 3, 'M': 3, 'F': 1, 'P': 7, 'S': 6, 'T': 9, 'W': 1, 'Y': 1, 'V': 17

Frequencies of Amino Acids

'A': 10.34%, 'R': 4.14%, 'N': 9.66%, 'D': 8.28%, 'C': 0%, 'Q': 4.83%, 'E': 6.21%, 'G': 8.28%, 'H': 3.45%, 'I': 4.83%, 'L': 6.9%, 'K': 2.07%, 'M': 2.07%, 'F': 0.69%, 'P': 4.83%, 'S': 4.14%, 'T': 6.21%, 'W': 0.69%, 'Y': 0.69%, 'V': 11.72%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15425 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.069	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.872	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.377	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.732	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.303	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-11.528	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.255, 0.269, 0.255 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.021	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Freeman MF, Gurgui C, Helf MJ, et al. Metagenome mining reveals polytheonamides as posttranslationally modified ribosomal peptides. Science. 2012;338(6105):387-90. Published 2012 Oct 19. doi:10.1126/science.1226121

PMID: 22983711

5.2 Protein Sequence Databases

UniProt: J9ZXD8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: J9ZXD8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JX456532	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036648, IPR022513

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download