AMPDB_335 | Late cornified envelope protein 3B
PEPTIDE SUMMARY
Late cornified envelope protein 3B
1 General Description
AMPDB ID: AMPDB_335
Protein Names: Late cornified envelope protein 3B (Late envelope protein 14)
Protein Family: LCE family
Gene Name: LCE3B LEP14
Source Organism: Homo sapiens (Human)
Protein Length: 95 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 7, 'N': 2, 'D': 3, 'C': 18, 'Q': 10, 'E': 1, 'G': 12, 'H': 3, 'I': 0, 'L': 3, 'K': 3, 'M': 1, 'F': 0, 'P': 11, 'S': 16, 'T': 0, 'W': 0, 'Y': 1, 'V': 0
Frequencies of Amino Acids
'A': 4.21%, 'R': 7.37%, 'N': 2.11%, 'D': 3.16%, 'C': 18.95%, 'Q': 10.53%, 'E': 1.05%, 'G': 12.63%, 'H': 3.16%, 'I': 0%, 'L': 3.16%, 'K': 3.16%, 'M': 1.05%, 'F': 0%, 'P': 11.58%, 'S': 16.84%, 'T': 0%, 'W': 0%, 'Y': 1.05%, 'V': 0%
Missing Amino Acid(s)
F, I, T, V, W
Most Occurring Amino Acid(s)
C
Less Occurring Amino Acid(s)
E, M, Y
Hydrophobic Amino Acid(s) Count
31
Hydrophilic Amino Acid(s) Count
64
Basic Amino Acid(s) Count
4
Acidic Amino Acid(s) Count
13
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9811.99 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 16.526 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 92.198 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.84 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.533 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.174 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 5.157 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.042, 0.432, 0.095 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.011 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 2615 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Gregory SG, Barlow KF, McLay KE, et al. The DNA sequence and biological annotation of human chromosome 1. Nature. 2006;441(7091):315-21. Published 2006 May 18. doi:10.1038/nature04727
PMID: 16710414
Citation 2: Jackson B, Tilli CM, Hardman MJ, et al. Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation. J Invest Dermatol. 2005;124(5):1062-70. Published 2005 May. doi:10.1111/j.0022-202X.2005.23699.x
PMID: 15854049
Citation 3: Niehues H, Tsoi LC, van der Krieken DA, et al. Psoriasis-Associated Late Cornified Envelope (LCE) Proteins Have Antibacterial Activity. J Invest Dermatol. 2017;137(11):2380-2388. Published 2017 Nov. doi:10.1016/j.jid.2017.06.003
PMID: 28634035
5.2 Protein Sequence Databases
UniProt: Q5TA77
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q5TA77
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AL139247 GenBank || EMBL
RefSeq: NP_848520.1
5.5 Protein-Protein Interaction Databases
IntAct: Q5TA77
MINT: Not found
DIP: Not found
BioGRID: 131649
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR028205
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
5.9 Phylogenomic Databases
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Q5TA77




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India