AMPDB_3338 | Palustrin-2AJ2
PEPTIDE SUMMARY
Palustrin-2AJ2
1 General Description
AMPDB ID: AMPDB_3338
Protein Names: Palustrin-2AJ2
Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily
Gene Name: Nil
Protein Length: 71 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MFTLKKPLLVLLFLGTVSLSLCEQERAADDDEGEVIEEEVKRGFMDTAKQVAKNVAVTLIDKLRCKVTGGC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 5, 'R': 3, 'N': 1, 'D': 5, 'C': 3, 'Q': 2, 'E': 7, 'G': 5, 'H': 0, 'I': 2, 'L': 10, 'K': 7, 'M': 2, 'F': 3, 'P': 1, 'S': 2, 'T': 5, 'W': 0, 'Y': 0, 'V': 8
Frequencies of Amino Acids
'A': 7.04%, 'R': 4.23%, 'N': 1.41%, 'D': 7.04%, 'C': 4.23%, 'Q': 2.82%, 'E': 9.86%, 'G': 7.04%, 'H': 0%, 'I': 2.82%, 'L': 14.08%, 'K': 9.86%, 'M': 2.82%, 'F': 4.23%, 'P': 1.41%, 'S': 2.82%, 'T': 7.04%, 'W': 0%, 'Y': 0%, 'V': 11.27%
Missing Amino Acid(s)
H, W, Y
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
N, P
Hydrophobic Amino Acid(s) Count
36
Hydrophilic Amino Acid(s) Count
35
Basic Amino Acid(s) Count
12
Acidic Amino Acid(s) Count
10
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7815.17 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 105.634 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 25.368 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.103 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.67 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.741 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -2.175 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.324, 0.127, 0.338 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.042 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 125 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Antioxidant, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Cytotoxin, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Chen Z, Yang X, Liu Z, et al. Two novel families of antimicrobial peptides from skin secretions of the Chinese torrent frog, Amolops jingdongensis. Biochimie. 2012;94(2):328-34. Published 2012 Feb. doi:10.1016/j.biochi.2011.07.021
PMID: 21816202
5.2 Protein Sequence Databases
UniProt: G3F828
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: G3F828
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. JF489155 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012521, IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India