AMPDB_333 | Late cornified envelope protein 3C

PEPTIDE SUMMARY

Late cornified envelope protein 3C

1 General Description

AMPDB ID: AMPDB_333

Protein Names: Late cornified envelope protein 3C (Late envelope protein 15) (Small proline-rich-like epidermal differentiation complex protein 3A)

Protein Family: LCE family

Gene Name: LCE3C LEP15 SPRL3A

Source Organism: Homo sapiens (Human)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 7, 'N': 2, 'D': 2, 'C': 14, 'Q': 11, 'E': 1, 'G': 13, 'H': 5, 'I': 0, 'L': 3, 'K': 2, 'M': 1, 'F': 1, 'P': 12, 'S': 18, 'T': 0, 'W': 0, 'Y': 0, 'V': 0

Frequencies of Amino Acids

'A': 2.13%, 'R': 7.45%, 'N': 2.13%, 'D': 2.13%, 'C': 14.89%, 'Q': 11.7%, 'E': 1.06%, 'G': 13.83%, 'H': 5.32%, 'I': 0%, 'L': 3.19%, 'K': 2.13%, 'M': 1.06%, 'F': 1.06%, 'P': 12.77%, 'S': 19.15%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 0%

Missing Amino Acid(s)

I, T, V, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9728.75 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	14.575	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	106.226	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.015	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.386	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.338	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.587	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.043, 0.479, 0.074 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.011	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Gregory SG, Barlow KF, McLay KE, et al. The DNA sequence and biological annotation of human chromosome 1. Nature. 2006;441(7091):315-21. Published 2006 May 18. doi:10.1038/nature04727

PMID: 16710414

Citation 2: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 3: Jackson B, Tilli CM, Hardman MJ, et al. Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation. J Invest Dermatol. 2005;124(5):1062-70. Published 2005 May. doi:10.1111/j.0022-202X.2005.23699.x

PMID: 15854049

Citation 4: Niehues H, Tsoi LC, van der Krieken DA, et al. Psoriasis-Associated Late Cornified Envelope (LCE) Proteins Have AntibacterialÂ Activity. J Invest Dermatol. 2017;137(11):2380-2388. Published 2017 Nov. doi:10.1016/j.jid.2017.06.003

PMID: 28634035

5.2 Protein Sequence Databases

UniProt: Q5T5A8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5T5A8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AL356426	GenBank \|\| EMBL
2.	CH878618	GenBank \|\| EMBL
3.	BC130365	GenBank \|\| EMBL
4.	BC130367	GenBank \|\| EMBL

CCDS: CCDS1015.1

RefSeq: NP_848521.1

5.5 Protein-Protein Interaction Databases

STRING: 9606.ENSP00000334644

IntAct: Q5T5A8

MINT: Not found

DIP: Not found

BioGRID: 131650

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR028205

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000163498

KEGG: hsa:353144

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000163498

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Q5T5A8

Download