AMPDB_3305 | Antimicrobial peptide ctriporin

PEPTIDE SUMMARY

Antimicrobial peptide ctriporin

1 General Description

AMPDB ID: AMPDB_3305

Protein Names: Antimicrobial peptide ctriporin (Riporin) (Non-disulfide-bridged peptide 4.10) (NDBP-4.10)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Chaerilus tricostatus (Scorpion)

Protein Length: 75 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MDSKYLFVFLIFNVIVIDLCQGFLWGLIPGAISAVTSLIKKGRRRRELGSQYDYLQDFRKRELDLDDLLSKFPDY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 6, 'N': 1, 'D': 8, 'C': 1, 'Q': 3, 'E': 2, 'G': 5, 'H': 0, 'I': 6, 'L': 12, 'K': 5, 'M': 1, 'F': 6, 'P': 2, 'S': 5, 'T': 1, 'W': 1, 'Y': 4, 'V': 4

Frequencies of Amino Acids

'A': 2.67%, 'R': 8%, 'N': 1.33%, 'D': 10.67%, 'C': 1.33%, 'Q': 4%, 'E': 2.67%, 'G': 6.67%, 'H': 0%, 'I': 8%, 'L': 16%, 'K': 6.67%, 'M': 1.33%, 'F': 8%, 'P': 2.67%, 'S': 6.67%, 'T': 1.33%, 'W': 1.33%, 'Y': 5.33%, 'V': 5.33%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, N, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8821.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.733	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.611	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.036	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.706	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.453	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.938	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.44, 0.173, 0.227 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.147	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11460, 11460	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), B.thuringiensis (Gram-positive), C.albicans, M.luteus (Gram-negative), S.aureus (Gram-positive), S.epidermidis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Fan Z, Cao L, He Y, et al. Ctriporin, a new anti-methicillin-resistant Staphylococcus aureus peptide from the venom of the scorpion Chaerilus tricostatus. Antimicrob Agents Chemother. 2011;55(11):5220-9. Published 2011 Nov. doi:10.1128/AAC.00369-11

PMID: 21876042

Citation 2: Zhao Z, Hong W, Zeng Z, et al. Mucroporin-M1 inhibits hepatitis B virus replication by activating the mitogen-activated protein kinase (MAPK) pathway and down-regulating HNF4Î± in vitro and in vivo. J Biol Chem. 2012;287(36):30181-90. Published 2012 Aug 31. doi:10.1074/jbc.M112.370312

PMID: 22791717

Citation 3: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: G1FE62

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: G1FE62

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JN172934	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download