AMPDB_32997 | Mucroporin-like peptide

PEPTIDE SUMMARY

Mucroporin-like peptide

1 General Description

AMPDB ID: AMPDB_32997

Protein Names: Mucroporin-like peptide (NDBP13)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Lychas mucronatus (Chinese swimming scorpion)

Protein Length: 73 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKVKCLLAVFLIVLIAAEHCQALFFLPSLIGGLISAFKGRRKRELGTQFQPRQKNFMRREVDLERLFAEMPDY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 7, 'N': 1, 'D': 2, 'C': 2, 'Q': 4, 'E': 5, 'G': 4, 'H': 1, 'I': 4, 'L': 11, 'K': 5, 'M': 3, 'F': 7, 'P': 3, 'S': 2, 'T': 1, 'W': 0, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 8.22%, 'R': 9.59%, 'N': 1.37%, 'D': 2.74%, 'C': 2.74%, 'Q': 5.48%, 'E': 6.85%, 'G': 5.48%, 'H': 1.37%, 'I': 5.48%, 'L': 15.07%, 'K': 6.85%, 'M': 4.11%, 'F': 9.59%, 'P': 4.11%, 'S': 2.74%, 'T': 1.37%, 'W': 0%, 'Y': 1.37%, 'V': 5.48%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, N, T, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8500.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	104.247	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.47	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.158	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.62	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.366	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.972	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.37, 0.137, 0.342 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.11	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1615	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ruiming Z, Yibao M, Yawen H, et al. Comparative venom gland transcriptome analysis of the scorpion Lychas mucronatus reveals intraspecific toxic gene diversity and new venomous components. BMC Genomics. 2010;11:452. Published 2010 Jul 28. doi:10.1186/1471-2164-11-452

PMID: 20663230

5.2 Protein Sequence Databases

UniProt: D9U2B8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: D9U2B8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU163896	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download