AMPDB_32909 | Temporin-SHe
PEPTIDE SUMMARY
Temporin-SHe
1 General Description
AMPDB ID: AMPDB_32909
Protein Names: Temporin-SHe (Temp-SHe)
Protein Family: Frog skin active peptide (FSAP) family; Temporin subfamily
Gene Name: Nil
Protein Length: 64 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MFTLKKSLLLLFFLGTINLSLCEQERDAEEERRDGTDESDVEVEKRFLPALAGIAGLLGKIFGK
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 4, 'N': 1, 'D': 4, 'C': 1, 'Q': 1, 'E': 8, 'G': 6, 'H': 0, 'I': 3, 'L': 12, 'K': 5, 'M': 1, 'F': 5, 'P': 1, 'S': 3, 'T': 3, 'W': 0, 'Y': 0, 'V': 2
Frequencies of Amino Acids
'A': 6.25%, 'R': 6.25%, 'N': 1.56%, 'D': 6.25%, 'C': 1.56%, 'Q': 1.56%, 'E': 12.5%, 'G': 9.38%, 'H': 0%, 'I': 4.69%, 'L': 18.75%, 'K': 7.81%, 'M': 1.56%, 'F': 7.81%, 'P': 1.56%, 'S': 4.69%, 'T': 4.69%, 'W': 0%, 'Y': 0%, 'V': 3.13%
Missing Amino Acid(s)
H, W, Y
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
C, M, N, P, Q
Hydrophobic Amino Acid(s) Count
34
Hydrophilic Amino Acid(s) Count
30
Basic Amino Acid(s) Count
12
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7173.31 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 106.719 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 39.836 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.03 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.508 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.536 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -3.049 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.344, 0.172, 0.391 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.078 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Leishmania, Trypanosoma
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Abbassi F, Lequin O, Piesse C, et al. Temporin-SHf, a new type of phe-rich and hydrophobic ultrashort antimicrobial peptide. J Biol Chem. 2010;285(22):16880-92. Published 2010 May 28. doi:10.1074/jbc.M109.097204
PMID: 20308076
5.2 Protein Sequence Databases
UniProt: D5GRW4
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: D5GRW4
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FN557008 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India