AMPDB_328 | Endochitinase 4

1 General Description

AMPDB ID: AMPDB_328

Protein Names: Endochitinase 4 (EC 3.2.1.14) (Chitinase class IV) (CJP-4) (allergen Cry j Chitinase)

Protein Family: Glycosyl hydrolase 19 family; Chitinase class IV subfamily

Gene Name: Nil

Source Organism: Cryptomeria japonica (Japanese cedar) (Cupressus japonica)

Protein Length: 281 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MQIMATQNSKSNIFWSSSASVVLVLLLLVDVGVCQNCGCNGLCCSQYGYCGSGEAYCGAGCKEGPCSSSSPPSTGTGVGSIVSSDVFNSIVGGAASGCAGNGFYTYDSFISAANAFNGFGTSGSSDVNKREIAAFFANAAHETGGFCYIEEQNPTSIYCDASNTQYPCASGKTYHGRGPLQLSWNYNYGAAGSYIQFDGLNNPEIVGTDSTISFKTAVWFWMVNSNCHTAITSGQGFGATIRAINSMECDGGNAATVASRVNYYQKFCQQLNVDTGSNLQC

FASTA format

Counts of Amino Acids

'A': 26, 'R': 4, 'N': 23, 'D': 9, 'C': 17, 'Q': 13, 'E': 8, 'G': 35, 'H': 3, 'I': 14, 'L': 11, 'K': 6, 'M': 4, 'F': 14, 'P': 7, 'S': 35, 'T': 17, 'W': 4, 'Y': 14, 'V': 17

Frequencies of Amino Acids

'A': 9.25%, 'R': 1.42%, 'N': 8.19%, 'D': 3.2%, 'C': 6.05%, 'Q': 4.63%, 'E': 2.85%, 'G': 12.46%, 'H': 1.07%, 'I': 4.98%, 'L': 3.91%, 'K': 2.14%, 'M': 1.42%, 'F': 4.98%, 'P': 2.49%, 'S': 12.46%, 'T': 6.05%, 'W': 1.42%, 'Y': 4.98%, 'V': 6.05%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

G, S

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

132

Hydrophilic Amino Acid(s) Count

149

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	29355.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	61.495	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.831	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.04	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.546	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.523	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-7.778	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.263, 0.356, 0.174 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	42860, 43860	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Fujimura T, Shigeta S, Suwa T, et al. Molecular cloning of a class IV chitinase allergen from Japanese cedar (Cryptomeria japonica) pollen and competitive inhibition of its immunoglobulin E-binding capacity by latex C-serum. Clin Exp Allergy. 2005;35(2):234-43. Published 2005 Feb. doi:10.1111/j.1365-2222.2005.02167.x

PMID: 15725197

Citation 2: Futamura N, Totoki Y, Toyoda A, et al. Characterization of expressed sequence tags from a full-length enriched cDNA library of Cryptomeria japonica male strobili. BMC Genomics. 2008;9:383. Published 2008 Aug 11. doi:10.1186/1471-2164-9-383

PMID: 18691438

Citation 3: Takashima T, Ohnuma T, Fukamizo T, et al. NMR assignments and ligand-binding studies on a two-domain family GH19 chitinase allergen from Japanese cedar (Cryptomeria japonica) pollen. Biomol NMR Assign. 2017;11(1):85-90. Published 2017 Apr. doi:10.1007/s12104-016-9725-4

PMID: 28032262

Citation 4: Takashima T, Ohnuma T, Fukamizo T, et al. NMR analysis of substrate binding to a two-domain chitinase: Comparison between soluble and insoluble chitins. Carbohydr Res. 2018;458-459:52-59. Published 2018 Mar 22. doi:10.1016/j.carres.2018.02.004

PMID: 29459179

Citation 5: Takashima T, Numata T, Taira T, et al. Structure and Enzymatic Properties of a Two-Domain Family GH19 Chitinase from Japanese Cedar ( Cryptomeria japonica) Pollen. J Agric Food Chem. 2018;66(22):5699-5706. Published 2018 Jun 6. doi:10.1021/acs.jafc.8b01140

PMID: 29756783

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q5NTA4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB196451	GenBank \|\| EMBL
2.	BY896705	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: Not found

PROSITE: PS00026, PS50941, PS00773, PS00774

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download