AMPDB_32693 | Amolopin-P2

PEPTIDE SUMMARY

Amolopin-P2

1 General Description

AMPDB ID: AMPDB_32693

Protein Names: Amolopin-P2

Protein Family: Frog skin active peptide (FSAP) family; Amolopin subfamily

Gene Name: Nil

Source Organism: Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis)

Protein Length: 62 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKSLLLLFFLGTISLSLCEQERGADEEENGGEVTEQEVKRNVLSSVANGINRALSFFG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 3, 'N': 4, 'D': 1, 'C': 1, 'Q': 2, 'E': 8, 'G': 6, 'H': 0, 'I': 2, 'L': 10, 'K': 3, 'M': 1, 'F': 5, 'P': 0, 'S': 6, 'T': 3, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 4.84%, 'R': 4.84%, 'N': 6.45%, 'D': 1.61%, 'C': 1.61%, 'Q': 3.23%, 'E': 12.9%, 'G': 9.68%, 'H': 0%, 'I': 3.23%, 'L': 16.13%, 'K': 4.84%, 'M': 1.61%, 'F': 8.06%, 'P': 0%, 'S': 9.68%, 'T': 4.84%, 'W': 0%, 'Y': 0%, 'V': 6.45%

Missing Amino Acid(s)

H, P, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, D, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6837.78 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	99.032	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.118	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.01	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.662	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.41	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.05	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.339, 0.258, 0.355 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.081	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), B.pumilus (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang A, Wang J, Hong J, et al. A novel family of antimicrobial peptides from the skin of Amolops loloensis. Biochimie. 2008;90(6):863-7. Published 2008 Jun. doi:10.1016/j.biochi.2008.02.003

PMID: 18312859

5.2 Protein Sequence Databases

UniProt: C5H0C8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C5H0C8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU311541	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download