AMPDB_32605 | Ribosome-inactivating protein lyophyllin

PEPTIDE SUMMARY

Ribosome-inactivating protein lyophyllin

1 General Description

AMPDB ID: AMPDB_32605

Protein Names: Ribosome-inactivating protein lyophyllin (EC 3.2.2.22)

Protein Family: Nil

Gene Name: Nil

Source Organism: Lyophyllum shimeji (Hon-shimeji) (Tricholoma shimeji)

Protein Length: 50 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 4, 'N': 2, 'D': 2, 'C': 1, 'Q': 2, 'E': 0, 'G': 2, 'H': 0, 'I': 3, 'L': 1, 'K': 1, 'M': 0, 'F': 3, 'P': 3, 'S': 4, 'T': 7, 'W': 1, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 16%, 'R': 8%, 'N': 4%, 'D': 4%, 'C': 2%, 'Q': 4%, 'E': 0%, 'G': 4%, 'H': 0%, 'I': 6%, 'L': 2%, 'K': 2%, 'M': 0%, 'F': 6%, 'P': 6%, 'S': 8%, 'T': 14%, 'W': 2%, 'Y': 2%, 'V': 10%

Missing Amino Acid(s)

E, H, M

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, K, L, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5358.08 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	76.2	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.566	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.096	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.466	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.441	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.936	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.28, 0.22, 0.18 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.1	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

P.piricola

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Anti-HIV

4.3 Enzymatic Activity

Hydrolase

4.4 Inhibitory Effect

Protein synthesis inhibitor

4.5 Other Biological Activity

Toxin, Anti-cancer, Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lam SK, Ng TB, Ng TB. First simultaneous isolation of a ribosome inactivating protein and an antifungal protein from a mushroom (Lyophyllum shimeji) together with evidence for synergism of their antifungal effects. Arch Biochem Biophys. 2001;393(2):271-80. Published 2001 Sep 15. doi:10.1006/abbi.2001.2506

PMID: 11556814

Citation 2: Chan WY, Ng TB, Lam JS, et al. The mushroom ribosome-inactivating protein lyophyllin exerts deleterious effects on mouse embryonic development in vitro. Appl Microbiol Biotechnol. 2010;85(4):985-93. Published 2010 Jan. doi:10.1007/s00253-009-2048-y

PMID: 19568748

Citation 3: Lu JQ, Shi WW, Xiao MJ, et al. Lyophyllin, a Mushroom Protein from the Peptidase M35 Superfamily Is an RNA N-Glycosidase. Int J Mol Sci. 2021;22(21). Published 2021 Oct 27. doi:10.3390/ijms222111598

PMID: 34769028

5.2 Protein Sequence Databases

UniProt: C0HLZ4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C0HLZ4

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR024079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download