AMPDB_3252 | Brevinin-2SN4

PEPTIDE SUMMARY

Brevinin-2SN4

1 General Description

AMPDB ID: AMPDB_3252

Protein Names: Brevinin-2SN4

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Sylvirana spinulosa (Fine-spined frog) (Hylarana spinulosa)

Protein Length: 72 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MFTMKKPMLLLFFLGMISMSLCQDERGADEDDGGEMTEEEKRGAFGDLLKGVAKEAGLKLLNMAQCKLSGNC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 2, 'N': 2, 'D': 5, 'C': 3, 'Q': 2, 'E': 7, 'G': 9, 'H': 0, 'I': 1, 'L': 11, 'K': 7, 'M': 7, 'F': 4, 'P': 1, 'S': 3, 'T': 2, 'W': 0, 'Y': 0, 'V': 1

Frequencies of Amino Acids

'A': 6.94%, 'R': 2.78%, 'N': 2.78%, 'D': 6.94%, 'C': 4.17%, 'Q': 2.78%, 'E': 9.72%, 'G': 12.5%, 'H': 0%, 'I': 1.39%, 'L': 15.28%, 'K': 9.72%, 'M': 9.72%, 'F': 5.56%, 'P': 1.39%, 'S': 4.17%, 'T': 2.78%, 'W': 0%, 'Y': 0%, 'V': 1.39%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, P, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7894.27 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.972	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.993	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.136	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.621	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.52	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.175	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.236, 0.208, 0.417 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yang X, Hu Y, Xu S, et al. Identification of multiple antimicrobial peptides from the skin of fine-spined frog, Hylarana spinulosa (Ranidae). Biochimie. 2013;95(12):2429-36. Published 2013 Dec. doi:10.1016/j.biochi.2013.09.002

PMID: 24055160

5.2 Protein Sequence Databases

UniProt: E7EKH7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: E7EKH7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	HQ735154	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012521, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download